Search Antibody, Protein, and ELISA Kit Solutions

SERPINA4 Antibody - middle region (ARP59241_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP59241_P050-FITC Conjugated

ARP59241_P050-HRP Conjugated

ARP59241_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
SERPINA4
Official Gene Full Name:
Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4
NCBI Gene Id:
5267
Protein Name:
Kallistatin
Swissprot Id:
P29622
Protein Accession #:
NP_006206
Nucleotide Accession #:
NM_006215
Alias Symbols:
KAL, KLST, KST, PI4, kallistatin, PI-4
Replacement Item:
This antibody may replace item sc-158652 from Santa Cruz Biotechnology.
Description of Target:
SERPINA4 inhibits human amidolytic and kininogenase activities of tissue kallikrein. Inhibition is achieved by formation of an equimolar, heat- and SDS-stable complex between the inhibitor and the enzyme, and generation of a small C-terminal fragment of the inhibitor due to cleavage at the reactive site by tissue kallikrein.
Protein Size (# AA):
427
Molecular Weight:
48kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SERPINA4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SERPINA4.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SERPINA4
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Zebrafish: 75%
Complete computational species homology data:
Anti-SERPINA4 (ARP59241_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FN1; RASA1; MAP4K2; MAPK6; ILK; NR4A1; YAE1D1; GADD45G; TAB1; TNFRSF14; TNNT1; KLK2; KLK1; CTSD;
Blocking Peptide:
For anti-SERPINA4 (ARP59241_P050) antibody is Catalog # AAP59241 (Previous Catalog # AAPP45230)
Datasheets/Manuals:
Printable datasheet for anti-SERPINA4 (ARP59241_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...