SERAC1 Antibody - C-terminal region (ARP60700_P050)

Catalog No: ARP60700_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: SERAC1
Sample Tissue: Human Thymus Tumor lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SERAC1
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 79%; Human: 100%; Rat: 79%
• Peptide Sequence: Synthetic peptide located within the following region: AVRKVLATSAKILRNPFADPFSTVDIEDHECAVWLLLRKSKSDDKTTRLE
• Concentration: 0.5 mg/ml
• Blocking Peptide: Catalog # AAP60700

Target Info

• Gene Symbol: SERAC1
• Gene Full Name: serine active site containing 1
• NCBI Gene Id: 84947
• Protein Name: Protein SERAC1
• Description of Target: The protein encoded by this gene is a phosphatidylglycerol remodeling protein found at the interface of mitochondria and endoplasmic reticula, where it mediates phospholipid exchange. The encoded protein plays a major role in mitochondrial function and intracellular cholesterol trafficking. Defects in this gene are a cause of 3-methylglutaconic aciduria with deafness, encephalopathy, and Leigh-like syndrome (MEGDEL). Two transcript variants, one protein-coding and the other non-protein coding, have been found for this gene.
• Uniprot ID: Q96JX3-3
• Protein Accession #: AAH28594.1
• Protein Size (# AA): 167
• Molecular Weight: 18 kDa
• Protein Interactions: APP;