ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: AVARP02014_P050
Price: $0.00
SKU
AVARP02014_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SEPT4 (septin-4) (AVARP02014_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Dog
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SEPT4 (septin-4)
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 84%; Human: 100%
Peptide SequenceSynthetic peptide located within the following region: RSLGWQGNSVPEDRTEAGIKRFLEDTTDDGELSKFVKDFSGNASCHPPEA
Concentration0.5 mg/ml
Blocking PeptideFor anti-SEPT4 (septin-4) (AVARP02014_P050) antibody is Catalog # AAP30429 (Previous Catalog # AAPP01012)
ReferenceElhasid,R., et al., (2004) Oncogene 23 (32), 5468-5475
Gene SymbolSEPT4
Gene Full NameSeptin 4
Alias SymbolsH5, ARTS, MART, SEP4, CE5B3, SEPT4, PNUTL2, hucep-7, BRADEION, C17orf47, hCDCREL-2
NCBI Gene Id5414
Protein NameSeptin-4
Description of TargetThe SEPT4 gene is a member of the septin gene family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse and appear to regulate cytoskeletal organization. SEPT4 encodes a protein that is thought to be part of a complex involved in cytokinesis.
Uniprot IDO43236
Protein Accession #NP_004565
Nucleotide Accession #NM_004574
Protein Size (# AA)478
Molecular Weight55kDa
Protein InteractionsXIAP; AREL1; UBC; Caskin1; SNCA; BIRC3; SIAH1; SEPT8; SNCAIP; SEPT4; SEPT5; SNCB; PARK2;
  1. What is the species homology for "SEPT4 Antibody - N-terminal region (AVARP02014_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Dog".

  2. How long will it take to receive "SEPT4 Antibody - N-terminal region (AVARP02014_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SEPT4 Antibody - N-terminal region (AVARP02014_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SEPT4 Antibody - N-terminal region (AVARP02014_P050)"?

    This target may also be called "H5, ARTS, MART, SEP4, CE5B3, SEPT4, PNUTL2, hucep-7, BRADEION, C17orf47, hCDCREL-2" in publications.

  5. What is the shipping cost for "SEPT4 Antibody - N-terminal region (AVARP02014_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SEPT4 Antibody - N-terminal region (AVARP02014_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SEPT4 Antibody - N-terminal region (AVARP02014_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "55kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SEPT4 Antibody - N-terminal region (AVARP02014_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SEPT4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SEPT4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SEPT4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SEPT4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SEPT4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SEPT4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SEPT4 Antibody - N-terminal region (AVARP02014_P050)
Your Rating