Search Antibody, Protein, and ELISA Kit Solutions

SENP8 Antibody - middle region : FITC (ARP73144_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73144_P050 Unconjugated

ARP73144_P050-HRP Conjugated

ARP73144_P050-Biotin Conjugated

Gene Symbol:
SENP8
NCBI Gene Id:
123228
Swissprot Id:
Q96LD8
Protein Accession #:
XP_005254214
Alias Symbols:
SENP8, DEN1, NEDP1, PRSC2, FKSG8,
Replacement Item:
This antibody may replace item sc-123457 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a cysteine protease that is a member of the sentrin-specific protease family. The encoded protein is involved in processing and deconjugation of the ubiquitin-like protein termed, neural precursor cell expressed developmentally downregulated 8. Alternate splicing results in multiple transcript variants.
Protein Size (# AA):
212
Molecular Weight:
23kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SENP8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SENP8.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human SENP8
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: THWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
SMURF1; COPS2; CUL1; GPS1; RPS14; PINK1; PARK2; USP28; USP21; USP15; CUL4A; CUL2; NEDD8; UBB; PLA2G2A; AKIP1;
Blocking Peptide:
For anti-SENP8 (ARP73144_P050-FITC) antibody is Catalog # AAP73144
Datasheets/Manuals:
Printable datasheet for anti-SENP8 (ARP73144_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...