Search Antibody, Protein, and ELISA Kit Solutions

SEMA6D Antibody - N-terminal region (ARP49583_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP49583_P050-FITC Conjugated

ARP49583_P050-HRP Conjugated

ARP49583_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
SEMA6D
Official Gene Full Name:
Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D
NCBI Gene Id:
80031
Protein Name:
Semaphorin-6D
Swissprot Id:
Q8NFY4
Protein Accession #:
NP_079242
Nucleotide Accession #:
NM_024966
Alias Symbols:
FLJ11598, KIAA1479
Replacement Item:
This antibody may replace item sc-367711 from Santa Cruz Biotechnology.
Description of Target:
Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphoring domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. SEMA6D is a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Six transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner.Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphorin domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. This gene encodes a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Six transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner.
Protein Size (# AA):
476
Molecular Weight:
52kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SEMA6D.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SEMA6D.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SEMA6D
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-SEMA6D (ARP49583_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLY
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PLXNA1;
Blocking Peptide:
For anti-SEMA6D (ARP49583_P050) antibody is Catalog # AAP49583 (Previous Catalog # AAPP13108)
Datasheets/Manuals:
Printable datasheet for anti-SEMA6D (ARP49583_P050) antibody
Target Reference:
Toyofuku,T., (2004) Genes Dev. 18 (4), 435-447

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...