Search Antibody, Protein, and ELISA Kit Solutions

SEMA6A Antibody - middle region (ARP49574_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP49574_P050-FITC Conjugated

ARP49574_P050-HRP Conjugated

ARP49574_P050-Biotin Conjugated

Gene Symbol:
SEMA6A
Official Gene Full Name:
Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A
NCBI Gene Id:
57556
Protein Name:
Semaphorin-6A
Swissprot Id:
Q9H2E6
Protein Accession #:
NP_065847
Nucleotide Accession #:
NM_020796
Alias Symbols:
HT018, KIAA1368, SEMA, SEMA6A1, SEMAQ, VIA, sema VIa
Replacement Item:
This antibody may replace item sc-112177 from Santa Cruz Biotechnology.
Description of Target:
SEMA6A can act as repulsive axon guidance cues. SEMA6A may play a role in channeling sympathetic axons into the sympathetic chains and controlling the temporal sequence of sympathetic target innervation.
Protein Size (# AA):
1030
Molecular Weight:
114kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SEMA6A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SEMA6A.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SEMA6A
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
Complete computational species homology data:
Anti-SEMA6A (ARP49574_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ERVPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SUMO1; SH3RF1; ITSN2; SORBS1; SORBS2; EVL;
Blocking Peptide:
For anti-SEMA6A (ARP49574_P050) antibody is Catalog # AAP49574 (Previous Catalog # AAPP29424)
Datasheets/Manuals:
Printable datasheet for anti-SEMA6A (ARP49574_P050) antibody
Sample Type Confirmation:

SEMA6A is supported by BioGPS gene expression data to be expressed in OVCAR3

Target Reference:
Prislei,S., (2008) Mol. Cancer Ther. 7 (1), 233-241

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...