Search Antibody, Protein, and ELISA Kit Solutions

SEMA4D Antibody - N-terminal region : Biotin (ARP61493_P050-Biotin)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP61493_P050 Unconjugated

ARP61493_P050-FITC Conjugated

ARP61493_P050-HRP Conjugated

Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
Official Gene Full Name:
Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
C9orf164, CD100, FLJ33485, FLJ34282, FLJ39737, FLJ46484, M-sema-G, MGC169138, MGC169141, SEMAJ, coll-4
Replacement Item:
This antibody may replace item sc-136250 from Santa Cruz Biotechnology.
Description of Target:
SEMA4D may play a functional role in the immune system, as well as in the nervous system. Induces B-cells to aggregate and improves their viability in vitro.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SEMA4D.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SEMA4D.
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SEMA4D (ARP61493_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SEDKKAKCAEKGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLN
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SEMA4D (ARP61493_P050-Biotin) antibody is Catalog # AAP61493 (Previous Catalog # AAPP47848)
Printable datasheet for anti-SEMA4D (ARP61493_P050-Biotin) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...