Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP61493_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP61493_P050-FITC Conjugated

ARP61493_P050-HRP Conjugated

ARP61493_P050-Biotin Conjugated

SEMA4D Antibody - N-terminal region (ARP61493_P050)

Catalog#: ARP61493_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-136250 from Santa Cruz Biotechnology.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-SEMA4D (ARP61493_P050)
Peptide SequenceSynthetic peptide located within the following region: SEDKKAKCAEKGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLN
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-SEMA4D (ARP61493_P050) antibody is Catalog # AAP61493 (Previous Catalog # AAPP47848)
Datasheets/ManualsPrintable datasheet for anti-SEMA4D (ARP61493_P050) antibody
Gene SymbolSEMA4D
Official Gene Full NameSema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D
Alias SymbolsC9orf164, CD100, FLJ33485, FLJ34282, FLJ39737, FLJ46484, M-sema-G, MGC169138, MGC169141, SEMAJ, coll-4
NCBI Gene Id10507
Protein NameSemaphorin-4D
Description of TargetSEMA4D may play a functional role in the immune system, as well as in the nervous system. Induces B-cells to aggregate and improves their viability in vitro.
Swissprot IdQ92854-2
Protein Accession #NP_001135759
Nucleotide Accession #NM_001142287
Protein Size (# AA)738
Molecular Weight81kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express SEMA4D.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express SEMA4D.
Protein InteractionsELAVL1; SEMA4D; PLXNB1; PTPRC; CD72;
Write Your Own Review
You're reviewing:SEMA4D Antibody - N-terminal region (ARP61493_P050)
Your Rating
Aviva Pathways
Free Microscope
Aviva Live Chat
Aviva Travel Grant