Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

SEMA4D Antibody - N-terminal region (ARP61493_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP61493_P050-FITC Conjugated

ARP61493_P050-HRP Conjugated

ARP61493_P050-Biotin Conjugated

Gene Symbol:
SEMA4D
Official Gene Full Name:
Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D
NCBI Gene Id:
10507
Protein Name:
Semaphorin-4D
Swissprot Id:
Q92854-2
Protein Accession #:
NP_001135759
Nucleotide Accession #:
NM_001142287
Alias Symbols:
C9orf164, CD100, FLJ33485, FLJ34282, FLJ39737, FLJ46484, M-sema-G, MGC169138, MGC169141, SEMAJ, coll-4
Replacement Item:
This antibody may replace item sc-136250 from Santa Cruz Biotechnology.
Description of Target:
SEMA4D may play a functional role in the immune system, as well as in the nervous system. Induces B-cells to aggregate and improves their viability in vitro.
Protein Size (# AA):
738
Molecular Weight:
81kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SEMA4D.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SEMA4D.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SEMA4D (ARP61493_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SEDKKAKCAEKGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ELAVL1; SEMA4D; PLXNB1; PTPRC; CD72;
Blocking Peptide:
For anti-SEMA4D (ARP61493_P050) antibody is Catalog # AAP61493 (Previous Catalog # AAPP47848)
Datasheets/Manuals:
Printable datasheet for anti-SEMA4D (ARP61493_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...