Search Antibody, Protein, and ELISA Kit Solutions

SEMA4B Antibody - N-terminal region : FITC (ARP49485_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP49485_P050 Unconjugated

ARP49485_P050-HRP Conjugated

ARP49485_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4B
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
KIAA1745, MGC131831, SEMAC, SemC
Replacement Item:
This antibody may replace item sc-160791 from Santa Cruz Biotechnology.
Description of Target:
SEMA4B is a single-pass type I membrane protein. It belongs to the semaphorin family. SEMA4B contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 PSI domain and 1 Sema domain. It inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SEMA4B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SEMA4B.
The immunogen is a synthetic peptide directed towards the N terminal region of human SEMA4B
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SEMA4B (ARP49485_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SEMA4B (ARP49485_P050-FITC) antibody is Catalog # AAP49485 (Previous Catalog # AAPS25108)
Printable datasheet for anti-SEMA4B (ARP49485_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...