Search Antibody, Protein, and ELISA Kit Solutions

SEMA4B Antibody - N-terminal region (ARP49485_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP49485_P050-FITC Conjugated

ARP49485_P050-HRP Conjugated

ARP49485_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4B
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
KIAA1745, MGC131831, SEMAC, SemC
Replacement Item:
This antibody may replace item sc-160791 from Santa Cruz Biotechnology.
Description of Target:
SEMA4B is a single-pass type I membrane protein. It belongs to the semaphorin family. SEMA4B contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 PSI domain and 1 Sema domain. It inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SEMA4B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SEMA4B.
The immunogen is a synthetic peptide directed towards the N terminal region of human SEMA4B
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SEMA4B (ARP49485_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SEMA4B (ARP49485_P050) antibody is Catalog # AAP49485 (Previous Catalog # AAPS25108)
Printable datasheet for anti-SEMA4B (ARP49485_P050) antibody
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...