Search Antibody, Protein, and ELISA Kit Solutions

SEMA3D antibody - middle region : FITC (ARP55526_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP55526_P050 Unconjugated

ARP55526_P050-HRP Conjugated

ARP55526_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC39708, Sema-Z2, coll-2
Replacement Item:
This antibody may replace item sc-10720 from Santa Cruz Biotechnology.
Description of Target:
SEMA3D induces the collapse and paralysis of neuronal growth cones. SEMA3D could potentially act as repulsive cues toward specific neuronal populations.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SEMA3D.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SEMA3D.
The immunogen is a synthetic peptide directed towards the middle region of human SEMA3D
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SEMA3D (ARP55526_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Blocking Peptide:
For anti-SEMA3D (ARP55526_P050-FITC) antibody is Catalog # AAP55526
Printable datasheet for anti-SEMA3D (ARP55526_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...