Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

SEMA3D Antibody - middle region (ARP55526_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP55526_P050-FITC Conjugated

ARP55526_P050-HRP Conjugated

ARP55526_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC39708, Sema-Z2, coll-2
Replacement Item:
This antibody may replace item sc-10720 from Santa Cruz Biotechnology.
Description of Target:
SEMA3D induces the collapse and paralysis of neuronal growth cones. SEMA3D could potentially act as repulsive cues toward specific neuronal populations.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SEMA3D.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SEMA3D.
The immunogen is a synthetic peptide directed towards the middle region of human SEMA3D
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SEMA3D (ARP55526_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SEMA3D (ARP55526_P050) antibody is Catalog # AAP55526
Printable datasheet for anti-SEMA3D (ARP55526_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...