Search Antibody, Protein, and ELISA Kit Solutions

SELPLG Antibody - N-terminal region (ARP65610_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP65610_P050-FITC Conjugated

ARP65610_P050-HRP Conjugated

ARP65610_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
SELPLG
Official Gene Full Name:
Selectin P ligand
NCBI Gene Id:
6404
Protein Name:
P-selectin glycoprotein ligand 1
Swissprot Id:
Q14242
Protein Accession #:
NP_002997
Nucleotide Accession #:
NM_003006
Alias Symbols:
CD162, CLA, PSGL-1, PSGL1
Replacement Item:
This antibody may replace item sc-159212 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P-, E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes. As such, this protein plays a critical role in leukocyte trafficking during inflammation by tethering of leukocytes to activated platelets or endothelia expressing selectins. This protein requires two post-translational modifications, tyrosine sulfation and the addition of the sialyl Lewis x tetrasaccharide (sLex) to its O-linked glycans, for its high-affinity binding activity. Aberrant expression of this gene and polymorphisms in this gene are associated with defects in the innate and adaptive immune response. Alternate splicing results in multiple transcript variants.
Protein Size (# AA):
412
Molecular Weight:
39kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SELPLG.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SELPLG.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SELPLG
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-SELPLG (ARP65610_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEMLR
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MAGEA1; TNIP1; PIK3R1; GALNT4; BACE1; TPST2; TPST1; SELL; SYK; MSN; SELP; SELE; VCAN; CTSG; SELPLG;
Blocking Peptide:
For anti-SELPLG (ARP65610_P050) antibody is Catalog # AAP65610
Datasheets/Manuals:
Printable datasheet for anti-SELPLG (ARP65610_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...