Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP65610_P050-FITC Conjugated

ARP65610_P050-HRP Conjugated

ARP65610_P050-Biotin Conjugated

SELPLG Antibody - N-terminal region (ARP65610_P050)

Catalog#: ARP65610_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-159212 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human SELPLG
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Complete computational species homology dataAnti-SELPLG (ARP65610_P050)
Peptide SequenceSynthetic peptide located within the following region: GNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEMLR
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-SELPLG (ARP65610_P050) antibody is Catalog # AAP65610
Datasheets/ManualsPrintable datasheet for anti-SELPLG (ARP65610_P050) antibody
Gene SymbolSELPLG
Official Gene Full NameSelectin P ligand
Alias SymbolsCD162, CLA, PSGL-1, PSGL1
NCBI Gene Id6404
Protein NameP-selectin glycoprotein ligand 1
Description of TargetThis gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P-, E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes. As such, this protein plays a critical role in leukocyte trafficking during inflammation by tethering of leukocytes to activated platelets or endothelia expressing selectins. This protein requires two post-translational modifications, tyrosine sulfation and the addition of the sialyl Lewis x tetrasaccharide (sLex) to its O-linked glycans, for its high-affinity binding activity. Aberrant expression of this gene and polymorphisms in this gene are associated with defects in the innate and adaptive immune response. Alternate splicing results in multiple transcript variants.
Swissprot IdQ14242
Protein Accession #NP_002997
Nucleotide Accession #NM_003006
Protein Size (# AA)412
Molecular Weight39kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express SELPLG.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express SELPLG.
Write Your Own Review
You're reviewing:SELPLG Antibody - N-terminal region (ARP65610_P050)
Your Rating
Aviva Pathways
Aviva Validation Data
Aviva Live Chat
Aviva HIS tag Deal