SELENOS Antibody - middle region (ARP48082_P050)

Catalog No: ARP48082_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-SELS Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SELS
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Goat: 75%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 93%; Yeast: 90%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SELENOS (ARP48082_P050) antibody is Catalog # AAP48082 (Previous Catalog # AAPS21301)
• Reference: Moses,E.K., Am. J. Obstet. Gynecol. 198 (3), 336 (2008)
• Publications:

  Du, S., Liu, H. & Huang, K. Influence of SelS gene silence on beta-Mercaptoethanol-mediated endoplasmic reticulum stress and cell apoptosis in HepG2 cells. Biochim. Biophys. Acta 1800, 511-7 (2010). 20114070

  Zeng, J., Du, S., Zhou, J. & Huang, K. Role of SelS in lipopolysaccharide-induced inflammatory response in hepatoma HepG2 cells. Arch. Biochem. Biophys. 478, 1-6 (2008). 18675776

Target Info

• Gene Symbol: SELENOS
• Gene Full Name: selenoprotein S
• Alias Symbols: SELS, VIMP, ADO15, SBBI8, SEPS1, AD-015
• NCBI Gene Id: 55829
• Protein Name: selenoprotein S
• Description of Target: This gene encodes a transmembrane protein that is localized in the endoplasmic reticulum (ER). It is involved in the degradation process of misfolded proteins in the ER, and may also have a role in inflammation control. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec). Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Two additional phylogenetically conserved stem-loop structures (Stem-loop 1 and Stem-loop 2) in the 3' UTR of this mRNA have been shown to function as modulators of Sec insertion. An alternatively spliced transcript variant, lacking the SECIS element and encoding a non-Sec containing shorter isoform, has been described for this gene (PMID:23614019).
• Uniprot ID: Q9BQE4
• Protein Accession #: NP_060915
• Nucleotide Accession #: NM_018445
• Protein Size (# AA): 189
• Molecular Weight: 21kDa
• Protein Interactions: UBC; SRPK2; PTGS2; CAV1; DERL2; APOB; DERL1; VCP; KPNB1; AMFR; SYVN1; HERPUD1; SAA1; SVIP; NPLOC4; UFD1L; HSPA4;