SELENOP Antibody - N-terminal region (ARP56299_P050)

Catalog No: ARP56299_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein may be modified by glycosylation.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SEPP1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Horse: 85%; Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SELENOP (ARP56299_P050) antibody is Catalog # AAP56299 (Previous Catalog # AAPP35502)
• Sample Type Confirmation:

  SEPP1 is supported by BioGPS gene expression data to be expressed in HEK293T

• Reference: Peters,U., (2008) Cancer Epidemiol. Biomarkers Prev. 17 (5), 1144-1154

Target Info

• Gene Symbol: SELENOP
• Gene Full Name: selenoprotein P
• Alias Symbols: SeP, SELP, SEPP, SEPP1
• NCBI Gene Id: 6414
• Protein Name: selenoprotein P
• Description of Target: This gene encodes a selenoprotein that is predominantly expressed in the liver and secreted into the plasma. This selenoprotein is unique in that it contains multiple selenocysteine (Sec) residues per polypeptide (10 in human), and accounts for most of the selenium in plasma. It has been implicated as an extracellular antioxidant, and in the transport of selenium to extra-hepatic tissues via apolipoprotein E receptor-2 (apoER2). Mice lacking this gene exhibit neurological dysfunction, suggesting its importance in normal brain function. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. The mRNA for this selenoprotein contains two SECIS elements. Alternatively spliced transcript variants have been found for this gene.
• Uniprot ID: P49908
• Protein Accession #: NP_001087195
• Nucleotide Accession #: NM_001093726
• Protein Size (# AA): 381
• Molecular Weight: 43 kDa
• Protein Interactions: EP300; MEOX2; THRA; EGFR;