Catalog No: ARP56299_P050
Price: $0.00
SKU
ARP56299_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SELENOP (ARP56299_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SEPP1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHorse: 85%; Human: 100%
Peptide SequenceSynthetic peptide located within the following region: LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL
Concentration0.5 mg/ml
Blocking PeptideFor anti-SELENOP (ARP56299_P050) antibody is Catalog # AAP56299 (Previous Catalog # AAPP35502)
Sample Type Confirmation

SEPP1 is supported by BioGPS gene expression data to be expressed in HEK293T

ReferencePeters,U., (2008) Cancer Epidemiol. Biomarkers Prev. 17 (5), 1144-1154
Gene SymbolSELENOP
Gene Full Nameselenoprotein P
Alias SymbolsSeP, SELP, SEPP, SEPP1
NCBI Gene Id6414
Protein Nameselenoprotein P
Description of TargetThis gene encodes a selenoprotein that is predominantly expressed in the liver and secreted into the plasma. This selenoprotein is unique in that it contains multiple selenocysteine (Sec) residues per polypeptide (10 in human), and accounts for most of the selenium in plasma. It has been implicated as an extracellular antioxidant, and in the transport of selenium to extra-hepatic tissues via apolipoprotein E receptor-2 (apoER2). Mice lacking this gene exhibit neurological dysfunction, suggesting its importance in normal brain function. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. The mRNA for this selenoprotein contains two SECIS elements. Alternatively spliced transcript variants have been found for this gene.
Uniprot IDP49908
Protein Accession #NP_001087195
Nucleotide Accession #NM_001093726
Protein Size (# AA)381
Molecular Weight43 kDa
Protein InteractionsEP300; MEOX2; THRA; EGFR;
  1. What is the species homology for "SELENOP Antibody - N-terminal region (ARP56299_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Horse".

  2. How long will it take to receive "SELENOP Antibody - N-terminal region (ARP56299_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SELENOP Antibody - N-terminal region (ARP56299_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SELENOP Antibody - N-terminal region (ARP56299_P050)"?

    This target may also be called "SeP, SELP, SEPP, SEPP1" in publications.

  5. What is the shipping cost for "SELENOP Antibody - N-terminal region (ARP56299_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SELENOP Antibody - N-terminal region (ARP56299_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SELENOP Antibody - N-terminal region (ARP56299_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "43 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SELENOP Antibody - N-terminal region (ARP56299_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SELENOP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SELENOP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SELENOP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SELENOP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SELENOP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SELENOP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SELENOP Antibody - N-terminal region (ARP56299_P050)
Your Rating