SELENOF Antibody - middle region (ARP48247_P050)

Catalog No: ARP48247_P050

WB Suggested Anti-SEP15 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Pig, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SEP15
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SELENOF (ARP48247_P050) antibody is Catalog # AAP48247 (Previous Catalog # AAPS23109)
• Reference: Jablonska,E., (2008) Eur J Nutr 47 (1), 47-54

Target Info

• Gene Symbol: SELENOF
• Gene Full Name: selenoprotein F
• Alias Symbols: SEP15
• NCBI Gene Id: 9403
• Protein Name: selenoprotein F
• Description of Target: The protein encoded by this gene belongs to the SEP15/selenoprotein M family. The exact function of this protein is not known; however, it has been found to associate with UDP-glucose:glycoprotein glucosyltransferase (UGTR), an endoplasmic reticulum(ER)-resident protein, which is involved in the quality control of protein folding. The association with UGTR retains this protein in the ER, where it may play a role in protein folding. It has also been suggested to have a role in cancer etiology. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec). Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene.
• Uniprot ID: O60613
• Protein Accession #: NP_004252
• Nucleotide Accession #: NM_004261
• Protein Size (# AA): 165
• Molecular Weight: 15kDa
• Protein Interactions: METTL23; UBC; DCUN1D1; CUL3; BAMBI; XRCC6; UGGT2; UGGT1;