Search Antibody, Protein, and ELISA Kit Solutions

SELENBP1 Antibody - C-terminal region (ARP48234_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP48234_P050-FITC Conjugated

ARP48234_P050-HRP Conjugated

ARP48234_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-160788 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human SELENBP1
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-SELENBP1 (ARP48234_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SELENBP1 (ARP48234_P050) antibody is Catalog # AAP48234 (Previous Catalog # AAPS23008)
Datasheets/Manuals:
Printable datasheet for anti-SELENBP1 (ARP48234_P050) antibody
Sample Type Confirmation:

SELENBP1 is supported by BioGPS gene expression data to be expressed in MCF7

Gene Symbol:
SELENBP1
Official Gene Full Name:
Selenium binding protein 1
Alias Symbols:
FLJ13813, LPSB, SP56, hSBP, hSP56, SBP56
NCBI Gene Id:
8991
Protein Name:
Selenium-binding protein 1
Description of Target:
SELENBP1 belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins.
Swissprot Id:
Q13228
Protein Accession #:
AAH32997
Nucleotide Accession #:
Q49AQ8
Protein Size (# AA):
408
Molecular Weight:
44kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SELENBP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SELENBP1.
Protein Interactions:
EED; GPX1; MLH1; BARD1; VMA21; COA7; SCAF4; TMED9; DPP7; WDHD1; SUCLG1; UQCRFS1P1; UQCRFS1; SUMO2; S100A4; PLAUR; MED31; TRA2A; GORASP2; USP15; LRIF1; POLDIP2; TRIP13; RPA1; USP33; AR;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...