Search Antibody, Protein, and ELISA Kit Solutions

SELENBP1 antibody - C-terminal region (ARP48234_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48234_P050-FITC Conjugated

ARP48234_P050-HRP Conjugated

ARP48234_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Selenium binding protein 1
Protein Name:
Selenium-binding protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ13813, LPSB, SP56, hSBP, hSP56, SBP56
Replacement Item:
This antibody may replace item sc-160788 from Santa Cruz Biotechnology.
Description of Target:
SELENBP1 belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SELENBP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SELENBP1.
The immunogen is a synthetic peptide directed towards the C terminal region of human SELENBP1
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-SELENBP1 (ARP48234_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SELENBP1 (ARP48234_P050) antibody is Catalog # AAP48234 (Previous Catalog # AAPS23008)
Printable datasheet for anti-SELENBP1 (ARP48234_P050) antibody
Sample Type Confirmation:

SELENBP1 is supported by BioGPS gene expression data to be expressed in MCF7

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...