Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: OAAF07625 (Formerly GWB-ASB530)
Size:100 ug
Price: $344.00
SKU
OAAF07625
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for SEK1/MKK4/JNKK1 Antibody (Phospho-Ser257) (OAAF07625)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
ClonalityPolyclonal
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin
Additional InformationModification Sites: Human:S257 Mouse:S255 Rat:S135
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from human SEK1/MKK4/JNKK1 around the phosphorylation site of Ser257.
PurificationThe antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Peptide SequenceSynthetic peptide located within the following region: LKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAP
Concentration1mg/ml
SpecificitySEK1/MKK4/JNKK1 (Phospho-Ser257) Antibody detects endogenous levels of SEK1/MKK4/JNKK1 only when phosphorylated at Ser257.
FormulationRabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info
IHC: 1:50~1:100
ELISA: 1:40000
Gene SymbolMAP2K4
Gene Full Namemitogen-activated protein kinase kinase 4
Alias Symbolsc-Jun N-terminal kinase kinase 1;dual specificity mitogen-activated protein kinase kinase 4;JNK-activated kinase 1;JNK-activating kinase 1;JNKK;JNKK1;MAP kinase kinase 4;MAPK/ERK kinase 4;MAPKK 4;MAPKK4;MEK 4;MEK4;MKK4;PRKMK4;SAPK/ERK kinase 1;SAPKK1;SAPKK-1;SEK1;SERK1;SKK1;stress-activated protein kinase kinase 1.
NCBI Gene Id6416
Protein NameDual specificity mitogen-activated protein kinase kinase 4
Description of TargetDual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. Essential component of the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. With MAP2K7/MKK7, is the one of the only known kinase to directly activate the stress-activated protein kinase/c-Jun N-terminal kinases MAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3. MAP2K4/MKK4 and MAP2K7/MKK7 both activate the JNKs by phosphorylation, but they differ in their preference for the phosphorylation site in the Thr-Pro-Tyr motif. MAP2K4 shows preference for phosphorylation of the Tyr residue and MAP2K7/MKK7 for the Thr residue. The phosphorylation of the Thr residue by MAP2K7/MKK7 seems to be the prerequisite for JNK activation at least in response to proinflammatory cytokines, while other stimuli activate both MAP2K4/MKK4 and MAP2K7/MKK7 which synergistically phosphorylate JNKs. MAP2K4 is required for maintaining peripheral lymphoid homeostasis. The MKK/JNK signaling pathway is also involved in mitochondrial death signaling pathway, including the release cytochrome c, leading to apoptosis. Whereas MAP2K7/MKK7 exclusively activates JNKs, MAP2K4/MKK4 additionally activates the p38 MAPKs MAPK11, MAPK12, MAPK13 and MAPK14.
Uniprot IDP45985
Molecular Weight44 kDa
  1. What is the species homology for "SEK1/MKK4/JNKK1 Antibody (Phospho-Ser257) (OAAF07625)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "SEK1/MKK4/JNKK1 Antibody (Phospho-Ser257) (OAAF07625)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "SEK1/MKK4/JNKK1 Antibody (Phospho-Ser257) (OAAF07625)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SEK1/MKK4/JNKK1 Antibody (Phospho-Ser257) (OAAF07625)"?

    This target may also be called "c-Jun N-terminal kinase kinase 1;dual specificity mitogen-activated protein kinase kinase 4;JNK-activated kinase 1;JNK-activating kinase 1;JNKK;JNKK1;MAP kinase kinase 4;MAPK/ERK kinase 4;MAPKK 4;MAPKK4;MEK 4;MEK4;MKK4;PRKMK4;SAPK/ERK kinase 1;SAPKK1;SAPKK-1;SEK1;SERK1;SKK1;stress-activated protein kinase kinase 1." in publications.

  5. What is the shipping cost for "SEK1/MKK4/JNKK1 Antibody (Phospho-Ser257) (OAAF07625)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SEK1/MKK4/JNKK1 Antibody (Phospho-Ser257) (OAAF07625)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SEK1/MKK4/JNKK1 Antibody (Phospho-Ser257) (OAAF07625)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SEK1/MKK4/JNKK1 Antibody (Phospho-Ser257) (OAAF07625)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MAP2K4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MAP2K4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MAP2K4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MAP2K4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MAP2K4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MAP2K4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SEK1/MKK4/JNKK1 Antibody (Phospho-Ser257) (OAAF07625)
Your Rating
We found other products you might like!