SECISBP2 Antibody (OAAL00805)

Catalog No: OAAL00805

Size:100UG

Western Blot analysis of SECISBP2 expression in transfected 293T cell line by SECISBP2 monoclonal antibody (M08), clone 3A7.
Lane 1: SECISBP2 transfected lysate (Predicted MW: 95.4 KDa).
Lane 2: Non-transfected lysate.

Detection limit for recombinant GST tagged SECISBP2 is 0.03 ng/ml as a capture antibody.

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 3A7
• Isotype: IgG2a Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: SECISBP2 (NP_076982.3, 106 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: VPGSQYLYNQPSCYRGFQTVKHRNENTCPLPQEMKALFKKKTYDEKKTYDQQKFDSERADGTISSEIKSARGSHHLSIYAENSLKSDGYHKRTDRKSRII
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: SECISBP2
• Gene Full Name: SECIS binding protein 2
• Alias Symbols: SBP2;Sec insertion sequence-binding protein 2;selenocysteine insertion sequence-binding protein 2.
• NCBI Gene Id: 79048
• Protein Name: Homo sapiens SECIS binding protein 2 (SECISBP2), transcript variant 1, mRNA|selenocysteine insertion sequence-binding protein 2 isoform 1 [Homo sapiens]
• Description of Target: The incorporation of selenocysteine into a protein requires the concerted action of an mRNA element called a sec insertion sequence (SECIS), a selenocysteine-specific translation elongation factor and a SECIS binding protein. With these elements in place, a UGA codon can be decoded as selenocysteine. The gene described in this record encodes a nuclear protein that functions as a SECIS binding protein. Mutations in this gene have been associated with a reduction in activity of a specific thyroxine deiodinase, a selenocysteine-containing enzyme, and abnormal thyroid hormone metabolism. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/NP_076982.3
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/NM_024077