Search Antibody, Protein, and ELISA Kit Solutions

SECISBP2 Antibody - middle region (ARP88236_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
SECISBP2
Official Gene Full Name:
SECIS binding protein 2
NCBI Gene Id:
79048
Protein Name:
selenocysteine insertion sequence-binding protein 2
Swissprot Id:
Q96T21-2
Protein Accession #:
NP_001269617.1
Nucleotide Accession #:
NM_001282688.1
Alias Symbols:
SBP2
Description of Target:
The incorporation of selenocysteine into a protein requires the concerted action of an mRNA element called a sec insertion sequence (SECIS), a selenocysteine-specific translation elongation factor and a SECIS binding protein. With these elements in place, a UGA codon can be decoded as selenocysteine. The gene described in this record encodes a nuclear protein that functions as a SECIS binding protein. Mutations in this gene have been associated with a reduction in activity of a specific thyroxine deiodinase, a selenocysteine-containing enzyme, and abnormal thyroid hormone metabolism. Alternate splicing results in multiple transcript variants.
Protein Size (# AA):
781
Molecular Weight:
85 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SECISBP2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SECISBP2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SECISBP2
Peptide Sequence:
Synthetic peptide located within the following region: QENAVSPAFTSDDTQDGESGGDDQFPEQAELSGPEGMDELISTPSVEDKS
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SECISBP2 (ARP88236_P050) antibody is Catalog # AAP88236
Datasheets/Manuals:
Printable datasheet for anti-SECISBP2 (ARP88236_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...