SEC23IP Antibody - N-terminal region (ARP52295_P050)

Catalog No: ARP52295_P050

WB Suggested Anti-SEC23IP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysateSEC23IP is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Host: Rabbit
Target Name: SEC23IP
Sample Tissue: Human THP-1 Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SEC23IP
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VPFIPVTQASASPASLLLPGEDSTDVGEEDSFLGQTSIHTSAPQTFSYFS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SEC23IP (ARP52295_P050) antibody is Catalog # AAP52295 (Previous Catalog # AAPP43722)
• Sample Type Confirmation:

  SEC23IP is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Info

• Gene Symbol: SEC23IP
• Gene Full Name: SEC23 interacting protein
• Alias Symbols: P125, P125A, MSTP053, iPLA1beta
• NCBI Gene Id: 11196
• Protein Name: SEC23-interacting protein
• Description of Target: COPII-coated vesicles are involved in protein transport from the endoplasmic reticulum to the Golgi apparatus. The protein encoded by this gene was identified by its interaction with a mouse protein similar to yeast Sec23p, an essential component of the COPII. This protein shares significant similarity with phospholipid-modifying proteins, especially phosphatidic acid preferring-phospholipase A1. Overexpression of this protein has been shown to cause disorganization of the endoplasmic reticulum-Golgi intermediate compartment and Golgi apparatus, which suggests its role in the early secretory pathway.
• Uniprot ID: Q9Y6Y8
• Protein Accession #: NP_009121
• Nucleotide Accession #: NM_007190
• Protein Size (# AA): 1000
• Molecular Weight: 111kDa
• Protein Interactions: SSC5D; HSPB11; UBC; WWOX; SEPT11; NUDCD2; ZNF518B; URM1; MTHFSD; TBC1D13; ZNF593; SSU72; DSTN; KYNU; UBE2H; TPM3; TPI1; PRDX2; XIAP; HERC2; TSG101; PCNA; POLD4;