SEC14L4 Antibody - N-terminal region : Biotin (ARP55734_P050-Biotin)

Catalog No: ARP55734_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SEC14L4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SEC14L4 (ARP55734_P050-Biotin) antibody is Catalog # AAP55734 (Previous Catalog # AAPP36441)
• Sample Type Confirmation:

  SEC14L4 is supported by BioGPS gene expression data to be expressed in OVCAR3

Target Info

• Reference: Mokashi,V., (2004) Biochem. Biophys. Res. Commun. 316 (3), 688-692
• Gene Symbol: SEC14L4
• Gene Full Name: SEC14-like 4 (S. cerevisiae)
• Alias Symbols: TAP3
• NCBI Gene Id: 284904
• Protein Name: SEC14-like protein 4
• Description of Target: SEC14L4 is a probable hydrophobic ligand-binding protein; may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids.The protein encoded by this gene is highly similar to the protein encoded by the Saccharomyces cerevisiae SEC14 gene. The SEC14 protein is a phophatidylinositol transfer protein that is essential for biogenesis of Golgi-derived transport vesicles, and thus is required for the export of yeast secretory proteins from the Golgi complex. The specific function of this protein has not yet been determined.
• Uniprot ID: Q9UDX3
• Protein Accession #: NP_777637
• Nucleotide Accession #: NM_174977
• Protein Size (# AA): 406
• Molecular Weight: 47kDa
• Protein Interactions: INCA1; BMF; USHBP1; TCF4; REL; ELAVL1; UBC;