SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP55734_P050
Price: $0.00
SKU
ARP55734_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SEC14L4 (ARP55734_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SEC14L4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-SEC14L4 (ARP55734_P050) antibody is Catalog # AAP55734 (Previous Catalog # AAPP36441)
Sample Type Confirmation

SEC14L4 is supported by BioGPS gene expression data to be expressed in OVCAR3

ReferenceMokashi,V., (2004) Biochem. Biophys. Res. Commun. 316 (3), 688-692
Gene SymbolSEC14L4
Gene Full NameSEC14-like 4 (S. cerevisiae)
Alias SymbolsTAP3
NCBI Gene Id284904
Protein NameSEC14-like protein 4
Description of TargetSEC14L4 is a probable hydrophobic ligand-binding protein; may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids.The protein encoded by this gene is highly similar to the protein encoded by the Saccharomyces cerevisiae SEC14 gene. The SEC14 protein is a phophatidylinositol transfer protein that is essential for biogenesis of Golgi-derived transport vesicles, and thus is required for the export of yeast secretory proteins from the Golgi complex. The specific function of this protein has not yet been determined.
Uniprot IDQ9UDX3
Protein Accession #NP_777637
Nucleotide Accession #NM_174977
Protein Size (# AA)406
Molecular Weight47kDa
Protein InteractionsINCA1; BMF; USHBP1; TCF4; REL; ELAVL1; UBC;
  1. What is the species homology for "SEC14L4 Antibody - N-terminal region (ARP55734_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "SEC14L4 Antibody - N-terminal region (ARP55734_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SEC14L4 Antibody - N-terminal region (ARP55734_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SEC14L4 Antibody - N-terminal region (ARP55734_P050)"?

    This target may also be called "TAP3" in publications.

  5. What is the shipping cost for "SEC14L4 Antibody - N-terminal region (ARP55734_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SEC14L4 Antibody - N-terminal region (ARP55734_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SEC14L4 Antibody - N-terminal region (ARP55734_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SEC14L4 Antibody - N-terminal region (ARP55734_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SEC14L4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SEC14L4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SEC14L4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SEC14L4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SEC14L4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SEC14L4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SEC14L4 Antibody - N-terminal region (ARP55734_P050)
Your Rating