SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP50178_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP50178_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

Sec11c Antibody - C-terminal region : FITC (ARP50178_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-Sec11c (ARP50178_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: VHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARG
Concentration0.5 mg/ml
Blocking PeptideFor anti-Sec11c (ARP50178_P050-FITC) antibody is Catalog # AAPp29631
SubunitSEC11C
Gene SymbolSec11c
Gene Full NameSEC11 homolog C (S. cerevisiae)
Alias SymbolsSec11, Sec11l3, 1810029G24Rik
NCBI Gene Id66286
Protein NameSignal peptidase complex catalytic subunit SEC11C
Description of TargetSec11c is a component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.
Uniprot IDQ9D8V7
Protein Accession #NP_079744
Nucleotide Accession #NM_025468
Protein Size (# AA)192
Molecular Weight22kDa
  1. What is the species homology for "Sec11c Antibody - C-terminal region : FITC (ARP50178_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "Sec11c Antibody - C-terminal region : FITC (ARP50178_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Sec11c Antibody - C-terminal region : FITC (ARP50178_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Sec11c Antibody - C-terminal region : FITC (ARP50178_P050-FITC)"?

    This target may also be called "Sec11, Sec11l3, 1810029G24Rik" in publications.

  5. What is the shipping cost for "Sec11c Antibody - C-terminal region : FITC (ARP50178_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Sec11c Antibody - C-terminal region : FITC (ARP50178_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Sec11c Antibody - C-terminal region : FITC (ARP50178_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "22kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Sec11c Antibody - C-terminal region : FITC (ARP50178_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SEC11C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SEC11C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SEC11C"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SEC11C"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SEC11C"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SEC11C"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Sec11c Antibody - C-terminal region : FITC (ARP50178_P050-FITC)
Your Rating
We found other products you might like!