Search Antibody, Protein, and ELISA Kit Solutions

SDF2 Antibody - N-terminal region : FITC (ARP48718_T100-FITC)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48718_T100 Unconjugated

ARP48718_T100-HRP Conjugated

ARP48718_T100-Biotin Conjugated

Gene Symbol:
SDF2
Official Gene Full Name:
Stromal cell-derived factor 2
NCBI Gene Id:
6388
Protein Name:
Stromal cell-derived factor 2
Swissprot Id:
Q99470
Protein Accession #:
NP_008854
Nucleotide Accession #:
NM_006923
Alias Symbols:
-
Replacement Item:
This antibody may replace item sc-100660 from Santa Cruz Biotechnology.
Description of Target:
SDF2 is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.The protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.
Protein Size (# AA):
211
Molecular Weight:
21kDa
Host:
Rabbit
Clonality:
Polyclonal
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SDF2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SDF2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SDF2
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-SDF2 (ARP48718_T100)
Peptide Sequence:
Synthetic peptide located within the following region: KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
HNRNPD; env; SUMO1; DMWD;
Blocking Peptide:
For anti-SDF2 (ARP48718_T100-FITC) antibody is Catalog # AAP48718 (Previous Catalog # AAPP28768)
Datasheets/Manuals:
Printable datasheet for anti-SDF2 (ARP48718_T100-FITC) antibody
Sample Type Confirmation:

SDF2 is supported by BioGPS gene expression data to be expressed in HepG2

Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Additional Information:
IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Target Reference:
Hamada,T., Gene 176 (1-2), 211-214 (1996)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...