Search Antibody, Protein, and ELISA Kit Solutions

SDE2 Antibody - middle region (ARP79926_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
SDE2
Official Gene Full Name:
SDE2 telomere maintenance homolog
NCBI Gene Id:
163859
Protein Name:
replication stress response regulator SDE2
Swissprot Id:
Q6IQ49
Protein Accession #:
NP_689821.3
Nucleotide Accession #:
NM_152608.3
Alias Symbols:
C1orf55, dJ671D7.1
Replacement Item:
This antibody may replace item sc-245649 from Santa Cruz Biotechnology.
Protein Size (# AA):
451
Molecular Weight:
49 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SDE2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SDE2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human C1ORF55
Peptide Sequence:
Synthetic peptide located within the following region: SMLRALGAQIEKTTNREACRDLSGRRLRDVNHEKAMAEWVKQQAEREAEK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SDE2 (ARP79926_P050) antibody is Catalog # AAP79926
Datasheets/Manuals:
Printable datasheet for anti-SDE2 (ARP79926_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...