Product Number |
P101699_T100 |
Product Page |
www.avivasysbio.com/nucb1-antibody-c-terminal-region-p101699-t100.html |
Name |
NUCB1 Antibody - C-terminal region (P101699_T100) |
Protein Size (# AA) |
459 amino acids |
Molecular Weight |
54kDa |
NCBI Gene Id |
84595 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Nucleobindin 1 |
Description |
|
Alias Symbols |
Nucb |
Peptide Sequence |
Synthetic peptide located within the following region: SQPDGQLQFRADTGDAPVPAPAGDQKDVPASEKKVPEQPPVLPQLDSQHL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Wendel,M., et al., 1995, J. Biol. Chem. 270 (11), 6125-6133 |
Description of Target |
An extracellular calcium binding protein of the mineralized matrix of bone [Calnuc or RGD:620030]. Also useful as a Golgi marker in immunohistochemistry (1:100 dilution). |
Protein Interactions |
STXBP5L; GNAI3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NUCB1 (P101699_T100) antibody |
Blocking Peptide |
For anti-NUCB1 (P101699_T100) antibody is Catalog # AAP32211 (Previous Catalog # AAPP03184) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
Uniprot ID |
Q63083 |
Protein Name |
Nucleobindin-1 |
Publications |
Lin, P. et al. Calnuc binds to Alzheimerâs beta-amyloid precursor protein and affects its biogenesis. J. Neurochem. 100, 1505-14 (2007). 17348862 |
Protein Accession # |
NP_445915 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_053463.1 |
Tested Species Reactivity |
Human, Rat |
Gene Symbol |
NUCB1 |
Predicted Species Reactivity |
Mouse, Rat, Dog |
Application |
IHC |
Predicted Homology Based on Immunogen Sequence |
Dog: 78%; Mouse: 92%; Rat: 100% |
Image 1 | Rat NRK
| Rat NRK |
|
|