HSF2 Antibody - middle region (P100979_P050)

Data Sheet
 
Product Number P100979_P050
Product Page www.avivasysbio.com/hsf2-antibody-middle-region-p100979-p050.html
Name HSF2 Antibody - middle region (P100979_P050)
Protein Size (# AA) 536 amino acids
Molecular Weight 60kDa
NCBI Gene Id 3298
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Heat shock transcription factor 2
Description
Alias Symbols HSF 2, HSTF 2
Peptide Sequence Synthetic peptide located within the following region: SSVQMNPTDYINNTKSENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Zhang,J., (2008) J. Biol. Chem. 283 (12), 7464-7469
Description of Target HSF2 binds specifically to the heat-shock element and has homology to HSFs of other species. Heat shock transcription factors activate heat-shock response genes under conditions of heat or other stresses. Although the names HSF1 and HSF2 were chosen for historical reasons, these peptides should be referred to as heat-shock transcription factors.HSF2, as well as the related gene HSF1, encodes a protein that binds specifically to the heat-shock element and has homology to HSFs of other species. Heat shock transcription factors activate heat-shock response genes under conditions of heat or other stresses. Although the names HSF1 and HSF2 were chosen for historical reasons, these peptides should be referred to as heat-shock transcription factors. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions NUP62; MTUS2; WDR5; TPM3; SUMO2; HSF4; HSF1; UBC; PCGF2; SUMO1; UBE2I; Zwint; FZR1; CUL3; CDC27; CDC20; PPP2R1A; NCAPG; HSF2BP; SUMO3; HSPA1A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HSF2 (P100979_P050) antibody
Blocking Peptide For anti-HSF2 (P100979_P050) antibody is Catalog # AAP31098 (Previous Catalog # AAPP01837)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HSF2
Uniprot ID Q03933
Protein Name Heat shock factor protein 2
Sample Type Confirmation

HSF2 is supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_004497
Purification Affinity Purified
Nucleotide Accession # NM_004506
Tested Species Reactivity Human, Mouse
Gene Symbol HSF2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Guinea Pig: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Image 1
Mouse Testis
Host: Mouse
Target Name: HSF2
Sample Tissue: Mouse Testis
Antibody Dilution: 1ug/ml
Image 2
Human 721_B
WB Suggested Anti-HSF2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: 721_B cell lysateHSF2 is supported by BioGPS gene expression data to be expressed in 721_B
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com