Product Number |
P100971_T100 |
Product Page |
www.avivasysbio.com/tbp-antibody-middle-region-p100971-t100.html |
Name |
TBP Antibody - middle region (P100971_T100) |
Protein Size (# AA) |
339 amino acids |
Molecular Weight |
38kDa |
NCBI Gene Id |
6908 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
TATA box binding protein |
Description |
|
Alias Symbols |
HDL4, GTF2D, SCA17, TFIID, GTF2D1 |
Peptide Sequence |
Synthetic peptide located within the following region: FSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Reid,S.J., et al., (2004) Brain Res. Mol. Brain Res. 125 (1-2), 120-128 |
Description of Target |
Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes TBP, the TATA-binding protein. A distinctive feature of TBP is a long string of glutamines in the N-terminal. This region of the protein modulates the DNA binding activity of the C terminus, and modulation of DNA binding affects the rate of transcription complex formation and initiation of transcription. Mutations that expand the number of CAG repeats encoding this polyglutamine tract, and thus increase the length of the polyglutamine string, are associated with spinocerebellar ataxia 17, a neurodegenerative disorder classified as a polyglutamine disease. |
Protein Interactions |
DR1; SSX2IP; GOLGA2; MEF2A; TAF8; GNG12; GNB2; UBC; UBE2I; TAF10; TAF5; HNF4A; E2F1; PAX5; TAF1A; TCEA1; RUVBL2; Abt1; GTF2A2; ICE2; tat; MED26; TBP; TAF6; TAF4; TAF1; SP1; TP53; SNAPC2; SNAPC1; MUC1; Taf1c; Taf1b; GTF2B; HCVgp1; AHR; TAF9B; BTAF1; TAF13; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TBP (P100971_T100) antibody |
Blocking Peptide |
For anti-TBP (P100971_T100) antibody is Catalog # AAP31331 (Previous Catalog # AAPP02082) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TBP |
Uniprot ID |
P20226 |
Protein Name |
TATA-box-binding protein |
Protein Accession # |
NP_003185 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_003194 |
Tested Species Reactivity |
Human |
Gene Symbol |
TBP |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100% |
Image 1 | Human Placenta
| WB Suggested Anti-TBP Antibody Titration: 2.5ug/ml Positive Control: Human Placenta |
|