TAL1 Antibody - middle region (P100970_T100)

Data Sheet
 
Product Number P100970_T100
Product Page www.avivasysbio.com/tal1-antibody-middle-region-p100970-t100.html
Name TAL1 Antibody - middle region (P100970_T100)
Protein Size (# AA) 331 amino acids
Molecular Weight 34kDa
NCBI Gene Id 6886
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name T-cell acute lymphocytic leukemia 1
Description
Alias Symbols SCL, TCL5, tal-1, bHLHa17
Peptide Sequence Synthetic peptide located within the following region: INFLAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Le Clech,M., et al., (2006) J. Mol. Biol. 355 (1), 9-19
Description of Target TAL1 is a basic helix-loop-helix transcription factor with a critical role in the development of both blood and endothelium
Protein Interactions ELSPBP1; SIN3A; KAT2B; EP300; HOXB9; DRG1; CHD3; ZHX1; STUB1; UBC; RB1; SSBP2; SSBP3; RCOR1; KDM1A; LDB1; TCF12; TCF3; RBBP7; LYL1; HDAC2; HDAC1; CHD4; CBFA2T3; RUNX1; SUPT16H; TAL1; CDK9; TRIM33; SUV39H1; SATB1; TRIM27; NCAPG2; MAPK3; SP1; LMO1; LMO2; GA
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TAL1 (P100970_T100) antibody
Blocking Peptide For anti-TAL1 (P100970_T100) antibody is Catalog # AAP31330
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TAL1
Uniprot ID P17542
Protein Name T-cell acute lymphocytic leukemia protein 1
Protein Accession # NP_003180
Purification Protein A purified
Nucleotide Accession # NM_003189
Tested Species Reactivity Human, Mouse
Gene Symbol TAL1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-TAL1 Antibody
Titration: 5 ug/ml
Positive Control: HepG2 Whole Cell
Image 2
Mouse Kidney
Host: Mouse
Target Name: TAL1
Sample Tissue: Mouse Kidney
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com