ELOC Antibody - N-terminal region (P100963_P050)

Data Sheet
 
Product Number P100963_P050
Product Page www.avivasysbio.com/eloc-antibody-n-terminal-region-p100963-p050.html
Name ELOC Antibody - N-terminal region (P100963_P050)
Protein Size (# AA) 112 amino acids
Molecular Weight 12kDa
NCBI Gene Id 6921
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name elongin C
Description
Alias Symbols SIII, TCEB1
Peptide Sequence Synthetic peptide located within the following region: EHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Yu,X., et al., (2003) Science 302 (5647), 1056-1060
Description of Target This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been identified.
Protein Interactions UBC; TCEB2; FUS; vif; METTL21C; SOCS4; CUL5; PRAME; POP1; MDM2; VHL; ASB18; ASB12; ASB14; ASB15; ASB9; ASB8; ASB7; ASB5; ASB10; ASB16; ASB13; ASB1; ASB3; APEX1; CUL2; Zswim8; ASB2; CPTP; CBX5; MRAS; JTB; RCAN2; SOCS1; CUL3; WNT7B; NEDD8; HIF1A; EFNB3; CYP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ELOC (P100963_P050) antibody
Blocking Peptide For anti-ELOC (P100963_P050) antibody is Catalog # AAP31321 (Previous Catalog # AAPP02071)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TCEB1
Uniprot ID Q15369
Protein Name elongin-C
Sample Type Confirmation

TCEB1 is strongly supported by BioGPS gene expression data to be expressed in Raji

Protein Accession # NP_005639
Purification Affinity Purified
Nucleotide Accession # NM_005648
Tested Species Reactivity Human
Gene Symbol ELOC
Predicted Species Reactivity Human, Dog, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Human: 100%; Zebrafish: 100%
Image 1
Human Raji
WB Suggested Anti-TCEB1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Raji cell lysateTCEB1 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com