SNAPC2 Antibody - middle region (P100961_T100)

Data Sheet
 
Product Number P100961_T100
Product Page www.avivasysbio.com/snapc2-antibody-middle-region-p100961-t100.html
Name SNAPC2 Antibody - middle region (P100961_T100)
Protein Size (# AA) 334 amino acids
Molecular Weight 36kDa
Subunit 2
NCBI Gene Id 6618
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Small nuclear RNA activating complex, polypeptide 2, 45kDa
Description
Alias Symbols SNAP45, PTFDELTA
Peptide Sequence Synthetic peptide located within the following region: STEEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVLDLLMSLPEELPL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Acierno,J.S. et al., () Genomics 73 (2), 203-210 -2001
Description of Target SNAPc is involved in transcription by two types of polymerases; it is required for transcription of both the RNA polymerase II and III small-nuclear RNA genes and binds specifically to the proximal sequence element PSE, a non-TATA-box basal promoter element common to these two types of genes. In addition, SNAPc is composed of at least three TAFs, SNAP43, SNAP45 and SNAP50.
Protein Interactions TBP; SNAPC4; SNAPC3; SNAPC1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SNAPC2 (P100961_T100) antibody
Blocking Peptide For anti-SNAPC2 (P100961_T100) antibody is Catalog # AAP31319 (Previous Catalog # AAPP08633)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SNAPC2
Uniprot ID Q13487
Protein Name snRNA-activating protein complex subunit 2
Protein Accession # NP_003074
Purification Protein A purified
Nucleotide Accession # NM_003083
Tested Species Reactivity Human
Gene Symbol SNAPC2
Predicted Species Reactivity Human
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human kidney
Immunohistochemistry with Human kidney lysate tissue
Image 2
Human Jurkat
WB Suggested Anti-SNAPC2 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com