PC4 Antibody - middle region (P100960_T100)

Data Sheet
 
Product Number P100960_T100
Product Page www.avivasysbio.com/pc4-antibody-middle-region-p100960-t100.html
Name PC4 Antibody - middle region (P100960_T100)
Protein Size (# AA) 127 amino acids
Molecular Weight 14kDa
NCBI Gene Id 10923
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name SUB1 homolog (S. cerevisiae)
Description
Alias Symbols P15, PC4, p14
Peptide Sequence Synthetic peptide located within the following region: NMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Banerjee,S., et al., (2004) Cell.Biol.24(5),2052-2062
Description of Target PC4 (activated RNA polymerase II transcription cofactor 4) is a transcriptional coactivator, possessing the ability to suppress promoter-driven as well as nonspecific transcription via its DNA binding activity. The repressive activity of PC4 on promoter-driven transcription is alleviated by transcription factor TFIIH. TFIIH protects promoters from PC4-mediated repression by relieving the topological constraint imposed by PC4 through the ERCC3 helicase activity.
Protein Interactions HUWE1; SUB1; UBC; rev; CLK4; CDK2; HNF4A; FN1; CSNK2A1; SMURF1; RPL18A; LAMP2; CDC5L; APP; YWHAZ; GTF3C1; ELAVL1; SUMO2; HDGF; Shoc2; Kif1c; POLR2B; POLR2A; CBX5; RCOR1; REST; BANF1; ADAP1; GTF2A1L; EP300; POU2AF1; CSTF2; TBP; TAF1; PCNA; HSF1; PSIP1; SP1
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SUB1 (P100960_T100) antibody
Blocking Peptide For anti-SUB1 (P100960_T100) antibody is Catalog # AAP31317 (Previous Catalog # AAPP02067)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PC4
Uniprot ID P53999
Protein Name Activated RNA polymerase II transcriptional coactivator p15
Sample Type Confirmation

There is BioGPS gene expression data showing that SUB1 is expressed in HepG2

Protein Accession # NP_006704
Purification Protein A purified
Nucleotide Accession # NM_006713
Tested Species Reactivity Human
Gene Symbol SUB1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Yeast, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 91%; Zebrafish: 100%
Image 1
Human Liver
Human Liver
Image 2
Human HepG2
WB Suggested Anti-PC4 Antibody Titration: 0.5-1.0ug/ml
Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that SUB1 is expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com