| Product Number |
P100958_P050 |
| Product Page |
www.avivasysbio.com/otx1-antibody-c-terminal-region-p100958-p050.html |
| Name |
OTX1 Antibody - C-terminal region (P100958_P050) |
| Protein Size (# AA) |
354 amino acids |
| Molecular Weight |
37kDa |
| NCBI Gene Id |
5013 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Orthodenticle homeobox 1 |
| Alias Symbols |
FLJ38361, MGC15736 |
| Peptide Sequence |
Synthetic peptide located within the following region: SGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASWRFQVL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hillier,L.W., (2005) Nature 434 (7034), 724-731 |
| Description of Target |
OTX1 is a member of the bicoid sub-family of homeodomain-containing transcription factors. OTX1 acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy. |
| Protein Interactions |
KRTAP10-3; KRTAP10-8; KRTAP10-5; KRTAP10-11; KRTAP10-1; KRTAP10-9; KRTAP12-2; LCE2D; LCE2A; LCE1B; LCE4A; MGAT5B; KRTAP3-3; KRTAP4-2; KRTAP4-7; KRTAP9-4; KRTAP9-2; KRTAP4-11; GEMIN8P4; KRTAP5-6; KRTAP26-1; KRTAP12-4; KRTAP3-2; KCNK16; KRTAP4-12; RGS17; RB |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-OTX1 (P100958_P050) antibody |
| Blocking Peptide |
For anti-OTX1 (P100958_P050) antibody is Catalog # AAP31315 (Previous Catalog # AAPP02065) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human OTX1 |
| Uniprot ID |
P32242 |
| Protein Name |
Homeobox protein OTX1 |
| Protein Accession # |
NP_055377 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_014562 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
OTX1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human 293T
 | WB Suggested Anti-OTX1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T |
|
|
