JUNB Antibody - N-terminal region (P100946_T100)

Data Sheet
 
Product Number P100946_T100
Product Page www.avivasysbio.com/junb-antibody-n-terminal-region-p100946-t100.html
Name JUNB Antibody - N-terminal region (P100946_T100)
Protein Size (# AA) 347 amino acids
Molecular Weight 36kDa
NCBI Gene Id 3726
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Jun B proto-oncogene
Description
Alias Symbols AP-1
Peptide Sequence Synthetic peptide located within the following region: MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Troen,G., (2004) J Mol Diagn 6 (4), 297-307
Description of Target The c-Jun proto-oncogene was first identified as the cellular homolog of the avian sarcoma virus v-Jun oncogene. The c-Jun protein, along with c-Fos, is a component of the AP-1 transcriptional complex. c-Jun can form either Jun/Jun homodimers or Jun/Fos heterodimers via the leucine repeats in both proteins. Jun B and Jun D, have been shown to be almost identical to c-Jun in their C-terminal regions, which are involved in dimerization and DNA binding, whereas their N-terminal domains, which are involved in transcriptional activation, diverge. JunB is involved in many types of human carcinoma including T-cell lymphomas, CML,primary cutaneous lymphomas. Aberrantly expressed c-Jun and JunB are a hallmark of Hodgkin lymphoma cells, stimulate proliferation and synergize with NF-kappa B. JunB potentiates function of BRCA1 activation domain 1 (AD1) through a coiled-coil-mediated interaction.JunB is an important regulator of erythroid Differentiation.
Protein Interactions BATF; FOS; RFWD2; C19orf68; USP24; TCERG1; ZNF595; PKIA; MAP2; APLP2; FOSL1; DDIT3; ATF3; BATF2; BATF3; TCL1A; FOSL2; NPM1; NEU1; SMAD4; HOXA7; BDNF; ATF4; MAPK6; UBC; TDG; SET; SAT1; MAPK9; BRCA1; SUMO2; Cebpb; EP300; SMURF1; YY1; CREBBP; SMARCA4; JDP2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-JUNB (P100946_T100) antibody
Blocking Peptide For anti-JUNB (P100946_T100) antibody is Catalog # AAP31301 (Previous Catalog # AAPP02050)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human JUNB
Uniprot ID P17275
Protein Name Transcription factor jun-B
Protein Accession # NP_002220
Purification Protein A purified
Nucleotide Accession # NM_002229
Tested Species Reactivity Human, Mouse
Gene Symbol JUNB
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92%
Image 1
Human 293T
WB Suggested Anti-JUNB Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T
Image 2
Mouse Kidney
Host: Mouse
Target Name: JUNB
Sample Tissue: Mouse Kidney
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com