HOXD10 Antibody - middle region (P100936_P050)

Data Sheet
 
Product Number P100936_P050
Product Page www.avivasysbio.com/hoxd10-antibody-middle-region-p100936-p050.html
Name HOXD10 Antibody - middle region (P100936_P050)
Protein Size (# AA) 340 amino acids
Molecular Weight 38kDa
NCBI Gene Id 3236
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Homeobox D10
Description
Alias Symbols HOX4, HOX4D, HOX4E, Hox-4.4
Peptide Sequence Synthetic peptide located within the following region: NPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gurnett,C.A., Clin. Orthop. Relat. Res. 462, 27-31 (2007)
Description of Target HOXD10 is the sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox D genes located on chromosome 2. The encoded nuclear protein functions as a sequence-specific transcription factor that is expressed in the developing limb buds and is involved in differentiation and limb development. Mutations in this gene have been associated with Wilm's tumor and congenital vertical talus (also known as 'rocker-bottom foot' deformity or congenital convex pes valgus) and/or a foot deformity resembling that seen in Charcot-Marie-Tooth disease. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions EP300; CREBBP; PBX1; GMNN; HMGB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HOXD10 (P100936_P050) antibody
Blocking Peptide For anti-HOXD10 (P100936_P050) antibody is Catalog # AAP31289 (Previous Catalog # AAPP02038)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HOXD10
Uniprot ID P28358
Protein Name Homeobox protein Hox-D10
Protein Accession # NP_002139
Purification Affinity Purified
Nucleotide Accession # NM_002148
Tested Species Reactivity Human
Gene Symbol HOXD10
Predicted Species Reactivity Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 92%
Image 1
Human PANC1
WB Suggested Anti-HOXD10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: PANC1 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com