| Product Number |
P100935_P050 |
| Product Page |
www.avivasysbio.com/hoxc6-antibody-c-terminal-region-p100935-p050.html |
| Name |
HOXC6 Antibody - C-terminal region (P100935_P050) |
| Protein Size (# AA) |
235 amino acids |
| Molecular Weight |
27kDa |
| NCBI Gene Id |
3223 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Homeobox C6 |
| Description |
|
| Alias Symbols |
CP25, HOX3, HOX3C, HHO.C8 |
| Peptide Sequence |
Synthetic peptide located within the following region: KIWFQNRRMKWKKESNLTSTLSGGGGGATADSLGGKEEKREETEEEKQKE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ramachandran,S., et al., (2005) Oncogene 24 (1), 188-198 |
| Description of Target |
HOXC6 belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons.This gene belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons. |
| Protein Interactions |
UBC; APP; HMGB1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HOXC6 (P100935_P050) antibody |
| Blocking Peptide |
For anti-HOXC6 (P100935_P050) antibody is Catalog # AAP31288 (Previous Catalog # AAPS31302) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human HOXC6 |
| Uniprot ID |
P09630 |
| Protein Name |
Homeobox protein Hox-C6 |
| Protein Accession # |
NP_004494 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_004503 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HOXC6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100% |
| Image 1 | Human DU145
 | WB Suggested Anti-HOXC6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: DU145 cell lysate |
|
|
