HOXC6 Antibody - C-terminal region (P100935_P050)

Data Sheet
 
Product Number P100935_P050
Product Page www.avivasysbio.com/hoxc6-antibody-c-terminal-region-p100935-p050.html
Name HOXC6 Antibody - C-terminal region (P100935_P050)
Protein Size (# AA) 235 amino acids
Molecular Weight 27kDa
NCBI Gene Id 3223
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Homeobox C6
Alias Symbols CP25, HOX3, HOX3C, HHO.C8
Peptide Sequence Synthetic peptide located within the following region: KIWFQNRRMKWKKESNLTSTLSGGGGGATADSLGGKEEKREETEEEKQKE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ramachandran,S., et al., (2005) Oncogene 24 (1), 188-198
Description of Target HOXC6 belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons.This gene belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons.
Protein Interactions UBC; APP; HMGB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HOXC6 (P100935_P050) antibody
Blocking Peptide For anti-HOXC6 (P100935_P050) antibody is Catalog # AAP31288 (Previous Catalog # AAPS31302)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human HOXC6
Uniprot ID P09630
Protein Name Homeobox protein Hox-C6
Protein Accession # NP_004494
Purification Affinity Purified
Nucleotide Accession # NM_004503
Tested Species Reactivity Human
Gene Symbol HOXC6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Image 1
Human DU145
WB Suggested Anti-HOXC6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: DU145 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com