Product Number |
P100932_T100 |
Product Page |
www.avivasysbio.com/hoxa10-antibody-n-terminal-region-p100932-t100.html |
Name |
HOXA10 Antibody - N-terminal region (P100932_T100) |
Protein Size (# AA) |
393 amino acids |
Molecular Weight |
41kDa |
NCBI Gene Id |
3206 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Homeobox A10 |
Description |
|
Alias Symbols |
PL, HOX1, HOX1H, HOX1.8 |
Peptide Sequence |
Synthetic peptide located within the following region: SLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Akbas,G.E., et al., (2004) J. Mol. Biol. 340 (5), 1013-1023 |
Description of Target |
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function in fertility, embryo viability, and regulation of hematopoietic lineage commitment. |
Protein Interactions |
SPI1; COPS5; CREBBP; PBX1; SNAPC1; EMX1; POLR3D; SIRT2; GMNN; EP300; MEIS1; PTPN6; HOXA10; FOXO1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-HOXA10 (P100932_T100) antibody |
Blocking Peptide |
For anti-HOXA10 (P100932_T100) antibody is Catalog # AAP31285 (Previous Catalog # AAPP02034) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HOXA10 |
Uniprot ID |
P31260 |
Protein Name |
Homeobox protein Hox-A10 |
Sample Type Confirmation |
There is BioGPS gene expression data showing that HOXA10 is expressed in Jurkat |
Protein Accession # |
NP_061824 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_018951 |
Tested Species Reactivity |
Human |
Gene Symbol |
HOXA10 |
Predicted Species Reactivity |
Human, Mouse, Cow, Dog, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-HOXA10 Antibody Titration: 0.5ug/ml Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that HOXA10 is expressed in Jurkat |
|
|