EN1 Antibody - C-terminal region (P100923_P050)

Data Sheet
Product Number P100923_P050
Product Page www.avivasysbio.com/en1-antibody-c-terminal-region-p100923-p050.html
Product Name EN1 Antibody - C-terminal region (P100923_P050)
Size 100 ul
Gene Symbol EN1
Alias Symbols -
Protein Size (# AA) 392 amino acids
Molecular Weight 40kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 2019
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Engrailed homeobox 1
Peptide Sequence Synthetic peptide located within the following region: LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK
Target Reference Atit,R., (2006) Dev. Biol. 296 (1), 164-176
Description of Target Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions TLE1; PAX6; JUN;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-EN1 (P100923_P050) antibody
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-EN1 (P100923_P050) antibody is Catalog # AAP31276 (Previous Catalog # AAPP02025)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human EN1
Complete computational species homology data Anti-EN1 (P100923_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EN1.
Swissprot Id Q05925
Protein Name Homeobox protein engrailed-1

Beltran, A. S., Graves, L. M. & Blancafort, P. Novel role of Engrailed 1 as a prosurvival transcription factor in basal-like breast cancer and engineering of interference peptides block its oncogenic function. Oncogene. 33, 4767-77 (2014). WB, Guinea Pig, Rabbit 24141779

Protein Accession # NP_001417
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EN1.
Nucleotide Accession # NM_001426
Replacement Item This antibody may replace item sc-128529 from Santa Cruz Biotechnology.
Tested Species Reactivity Human
Predicted Species Reactivity Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Guinea Pig: 93%; Rabbit: 86%
Image 1
Human HepG2
WB Suggested Anti-EN1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Image 2
Human HT1080 Whole Cell
Host: Rabbit
Target Name: EN1
Sample Tissue: Human HT1080 Whole Cell
Antibody Dilution: 1ug/ml

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com