CSDA Antibody - C-terminal region (P100917_T100)

Data Sheet
 
Product Number P100917_T100
Product Page www.avivasysbio.com/csda-antibody-c-terminal-region-p100917-t100.html
Name CSDA Antibody - C-terminal region (P100917_T100)
Protein Size (# AA) 372 amino acids
Molecular Weight 40kDa
NCBI Gene Id 8531
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Cold shock domain protein A
Alias Symbols CSDA, DBPA, CSDA1, ZONAB
Peptide Sequence Synthetic peptide located within the following region: GPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hayashi, J. et al, (2002) Int. J. Oncol. 21 (4), 847-850
Description of Target Human DNA-binding protein (dbpA) is a member of a Y-box binding protein family containing a cold shock domain. The increased expression of Y box binding proteins in somatic cells is associated with cell proliferation and transformation.
Protein Interactions CEP76; CEP250; UBC; SUZ12; RNF2; EZH2; BMI1; C14orf166; RTCB; NELFB; MACF1; IGF2BP3; EIF5B; MAP7; EIF2B2; EIF2B3; RFC4; PTBP1; NMT1; MRE11A; ILF2; HNRNPU; DHX9; DDX1; CSRP1; ABCF1; PARK2; SRPK3; TARDBP; ICAM1; IGSF8; HDAC11; PAN2; IL7R; IFIT3; IFIT2; ESR1
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-YBX3 (P100917_T100) antibody
Blocking Peptide For anti-YBX3 (P100917_T100) antibody is Catalog # AAP31269 (Previous Catalog # AAPP02018)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CSDA
Uniprot ID P16989
Protein Name DNA-binding protein A
Sample Type Confirmation

YBX3 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Protein Accession # NP_003642
Purification Protein A purified
Nucleotide Accession # NM_003651
Tested Species Reactivity Human
Gene Symbol YBX3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 91%; Horse: 100%; Human: 100%; Mouse: 91%; Pig: 100%; Rabbit: 100%; Rat: 91%
Image 1
Human HEK293T
Host: Rabbit
Target Name: CSDA
Sample Tissue: Human HEK293T
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com