| Product Number |
P100907_T100 |
| Product Page |
https://www.avivasysbio.com/pou3f4-antibody-c-terminal-region-p100907-t100.html |
| Name |
POU3F4 Antibody - C-terminal region (P100907_T100) |
| Protein Size (# AA) |
361 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
5456 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
POU class 3 homeobox 4 |
| Description |
|
| Alias Symbols |
BRN4, DFN3, OTF9, BRN-4, DFNX2, OCT-9, OTF-9, BRAIN-4 |
| Peptide Sequence |
Synthetic peptide located within the following region: ADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSHTVKTDTSCHDL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Xia,A.P., et al., (2002) Hear.Res.166(1-2),150-158 |
| Description of Target |
POU3F4 (brain-specific homeobox/POU domain protein 4, brain-4, Brn-4, transcription factor 4) is a transcription factor with a POU domain. |
| Protein Interactions |
HNRNPU; POU3F3; POU3F1; POU3F2; POU3F4; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-POU3F4 (P100907_T100) antibody |
| Blocking Peptide |
For anti-POU3F4 (P100907_T100) antibody is Catalog # AAP31255 (Previous Catalog # AAPP02004) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human POU3F4 |
| Uniprot ID |
P49335 |
| Protein Name |
POU domain, class 3, transcription factor 4 |
| Publications |
Emanuele Bernardinelli, Sebastian Roesch, Edi Simoni, Angela Marino, Gerd Rasp, Laura Astolfi, Antonio Sarikas, Silvia Dossena. Novel POU3F4 variants identified in patients with inner ear malformations exhibit aberrant cellular distribution and lack of SLC6A20 transcriptional upregulation.. Front Mol Neurosci. 15, 999833 (2022). 36245926
|
| Protein Accession # |
NP_000298 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_000307 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
POU3F4 |
| Predicted Species Reactivity |
Human, Mouse, Cow, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-POU3F4 Antibody Titration: 0.3-0.5ug/ml
Positive Control: HepG2 cell lysate |
|
