ZBTB6 Antibody - N-terminal region (P100900_P050)

• Product Number: P100900_P050
• Name: ZBTB6 Antibody - N-terminal region (P100900_P050)
• Protein Size (# AA): 424 amino acids
• Molecular Weight: 48kDa
• NCBI Gene Id: 10773
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Zinc finger and BTB domain containing 6
• Description:
  View product citations for ZBTB6 Antibody - N-terminal region (P100900_P050)on CiteAb
• Alias Symbols: ZID, ZNF482
• Peptide Sequence: Synthetic peptide located within the following region: SDPDVKNEDENSDKDCEIIEISEDSPVNIDFHVKEEESNALQSTVESLTS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Colland,F., (2004) Genome Res. 14 (7), 1324-1332
• Description of Target: ZBTB6 contains 1 BTB (POZ) domain and 4 C2H2-type zinc fingers. ZBTB6 may be involved in transcriptional regulation.
• Protein Interactions: SUMO1P1; ZBTB26; SUMO1; SKIL; NACC1; ZBTB6; ATF7IP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZBTB6 (P100900_P050) antibody is Catalog # AAP31248 (Previous Catalog # AAPP01993)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB6
• Uniprot ID: Q15916
• Protein Name: Zinc finger and BTB domain-containing protein 6
• Protein Accession #: NP_006617
• Purification: Affinity Purified
• Nucleotide Accession #: NM_006626
• Tested Species Reactivity: Human
• Gene Symbol: ZBTB6
• Predicted Species Reactivity: Human, Mouse, Cow, Horse, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 92%
• Image 1: Human NTERA2
  
  WB Suggested Anti-ZBTB6 Antibody Titration: 0.2-1 ug/ml
  Positive Control: NTERA2 cell lysate