Product Number |
P100894_T100 |
Product Page |
www.avivasysbio.com/gtf2h2-antibody-c-terminal-region-p100894-t100.html |
Name |
GTF2H2 Antibody - C-terminal region (P100894_T100) |
Protein Size (# AA) |
395 amino acids |
Molecular Weight |
44kDa |
Subunit |
2 |
NCBI Gene Id |
2966 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
General transcription factor IIH, polypeptide 2, 44kDa |
Description |
|
Alias Symbols |
p44, BTF2, TFIIH, BTF2P44, T-BTF2P44 |
Peptide Sequence |
Synthetic peptide located within the following region: CELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Le May,N., et al., (2004) Cell 116 (4), 541-550 |
Description of Target |
GTF2 is encoded by a gene that is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This gene is within the telomeric copy of the duplication. Deletion of this gene sometimes accompanies deletion of the neighboring SMN1 gene in spinal muscular atrophy (SMA) patients but it is unclear if deletion of this gene contributes to the SMA phenotype. This gene encodes the 44 kDa subunit of RNA polymerase II transcription initiation factor IIH which is involved in basal transcription and nucleotide excision repair. Transcript variants for this gene have been described, but their full length nature has not been determined. A second copy of this gene within the centromeric copy of the duplication has been described in the literature. It is reported to be different by either two or four base pairs; however, no sequence data is currently available for the centromeric copy of the gene. |
Protein Interactions |
UBC; CDK7; GTF2H5; GTF2H1; SRA1; GTF2H4; GTF2H3; UBD; COPS2; ERCC3; ERCC8; ERCC2; AR; MNAT1; CCNH; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GTF2H2 (P100894_T100) antibody |
Blocking Peptide |
For anti-GTF2H2 (P100894_T100) antibody is Catalog # AAP31242 (Previous Catalog # AAPP01987) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human GTF2H2 |
Uniprot ID |
Q13888 |
Protein Name |
General transcription factor IIH subunit 2 |
Sample Type Confirmation |
GTF2H2 is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_001506 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001515 |
Tested Species Reactivity |
Human |
Gene Symbol |
GTF2H2 |
Predicted Species Reactivity |
Human, Mouse, Dog, Horse, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 92%; Horse: 92%; Human: 100%; Mouse: 85%; Zebrafish: 85% |
Image 1 | Human 293T
| Host: Rabbit Target Name: GTF2H2 Sample Tissue: Human 293T Antibody Dilution: 1.0ug/ml |
|
Image 2 | Human Lung
| Human Lung |
|