GTF2H2 Antibody - C-terminal region (P100894_T100)

Data Sheet
 
Product Number P100894_T100
Product Page www.avivasysbio.com/gtf2h2-antibody-c-terminal-region-p100894-t100.html
Name GTF2H2 Antibody - C-terminal region (P100894_T100)
Protein Size (# AA) 395 amino acids
Molecular Weight 44kDa
Subunit 2
NCBI Gene Id 2966
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name General transcription factor IIH, polypeptide 2, 44kDa
Description
Alias Symbols p44, BTF2, TFIIH, BTF2P44, T-BTF2P44
Peptide Sequence Synthetic peptide located within the following region: CELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Le May,N., et al., (2004) Cell 116 (4), 541-550
Description of Target GTF2 is encoded by a gene that is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This gene is within the telomeric copy of the duplication. Deletion of this gene sometimes accompanies deletion of the neighboring SMN1 gene in spinal muscular atrophy (SMA) patients but it is unclear if deletion of this gene contributes to the SMA phenotype. This gene encodes the 44 kDa subunit of RNA polymerase II transcription initiation factor IIH which is involved in basal transcription and nucleotide excision repair. Transcript variants for this gene have been described, but their full length nature has not been determined. A second copy of this gene within the centromeric copy of the duplication has been described in the literature. It is reported to be different by either two or four base pairs; however, no sequence data is currently available for the centromeric copy of the gene.
Protein Interactions UBC; CDK7; GTF2H5; GTF2H1; SRA1; GTF2H4; GTF2H3; UBD; COPS2; ERCC3; ERCC8; ERCC2; AR; MNAT1; CCNH;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GTF2H2 (P100894_T100) antibody
Blocking Peptide For anti-GTF2H2 (P100894_T100) antibody is Catalog # AAP31242 (Previous Catalog # AAPP01987)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GTF2H2
Uniprot ID Q13888
Protein Name General transcription factor IIH subunit 2
Sample Type Confirmation

GTF2H2 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_001506
Purification Protein A purified
Nucleotide Accession # NM_001515
Tested Species Reactivity Human
Gene Symbol GTF2H2
Predicted Species Reactivity Human, Mouse, Dog, Horse, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 92%; Horse: 92%; Human: 100%; Mouse: 85%; Zebrafish: 85%
Image 1
Human 293T
Host: Rabbit
Target Name: GTF2H2
Sample Tissue: Human 293T
Antibody Dilution: 1.0ug/ml
Image 2
Human Lung
Human Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com