| Product Number |
P100888_P050 |
| Product Page |
www.avivasysbio.com/trim22-antibody-n-terminal-region-p100888-p050.html |
| Name |
TRIM22 Antibody - N-terminal region (P100888_P050) |
| Protein Size (# AA) |
498 amino acids |
| Molecular Weight |
57kDa |
| NCBI Gene Id |
10346 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Tripartite motif containing 22 |
| Description |
|
| Alias Symbols |
RNF94, STAF50, GPSTAF50 |
| Peptide Sequence |
Synthetic peptide located within the following region: LANIVERVKEVKMSPQEGQKRDVCEHHGKKLQIFCKEDGKVICWVCELSQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Obad,S., (2007) J. Interferon Cytokine Res. 27 (10), 857-864 |
| Description of Target |
TRIM22 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. It localizes to the cytoplasm and its expression is induced by interferon. The protein down-regulates transcription from the HIV-1 LTR promoter region, suggesting that function of this protein may be to mediate interferon's antiviral effects.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the cytoplasm and its expression is induced by interferon. The protein down-regulates transcription from the HIV-1 LTR promoter region, suggesting that function of this protein may be to mediate interferon's antiviral effects. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
EIF4E; UBC; TAB2; CASK; CIC; TRIM22; USP7; RERE; ZZZ3; TAF7; CREB1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TRIM22 (P100888_P050) antibody |
| Blocking Peptide |
For anti-TRIM22 (P100888_P050) antibody is Catalog # AAP31235 (Previous Catalog # AAPP01980) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM22 |
| Uniprot ID |
Q8IYM9 |
| Protein Name |
E3 ubiquitin-protein ligase TRIM22 |
| Protein Accession # |
NP_006065 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006074 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TRIM22 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Brain
 | WB Suggested Anti-TRIM22 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain |
| | Image 2 | Human Lung, NTERA-2 Cell Lysate
 | Host: Rabbit
Target: TRIM22
Positive control (+): Human Lung (LU)
Negative control (-): NTERA-2 Cell Lysate (N27)
Antibody concentration: 1ug/ml |
|
|
