| Product Number |
P100885_T100-HRP |
| Product Page |
www.avivasysbio.com/snapc1-antibody-c-terminal-region-hrp-p100885-t100-hrp.html |
| Name |
SNAPC1 Antibody - C-terminal region : HRP (P100885_T100-HRP) |
| Protein Size (# AA) |
368 amino acids |
| Molecular Weight |
43kDa |
| Subunit |
1 |
| Conjugation |
HRP: Horseradish Peroxidase |
| NCBI Gene Id |
6617 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Small nuclear RNA activating complex, polypeptide 1, 43kDa |
| Alias Symbols |
SNAP43, PTFgamma |
| Peptide Sequence |
Synthetic peptide located within the following region: KMSLRNKGNVQNIHKEDKPLSLSMPVITEEEENESLSGTEFTASKKRRKH |
| Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Reference |
Gu,L., (2005) J. Biol. Chem. 280 (30), 27697-27704 |
| Description of Target |
SNAPC1 is a part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. It binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes and recruits TBP and BRF2 to the U6 snRNA TATA box. |
| Protein Interactions |
UBC; TBP; SNAPC2; RHOXF2; TRIM29; NR2E3; HOXA10; SNAPC4; SNAPC3; RB1; SNAPC5; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-SNAPC1 (P100885_T100-HRP) antibody |
| Blocking Peptide |
For anti-SNAPC1 (P100885_T100-HRP) antibody is Catalog # AAP31223 (Previous Catalog # AAPP01968) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human SNAPC1 |
| Uniprot ID |
Q16533 |
| Protein Name |
snRNA-activating protein complex subunit 1 |
| Protein Accession # |
NP_003073 |
| Nucleotide Accession # |
NM_003082 |
| Gene Symbol |
SNAPC1 |
| Predicted Species Reactivity |
Human |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | |
|
