SNAPC1 Antibody - C-terminal region (P100885_T100)

Data Sheet
 
Product Number P100885_T100
Product Page www.avivasysbio.com/snapc1-antibody-c-terminal-region-p100885-t100.html
Name SNAPC1 Antibody - C-terminal region (P100885_T100)
Protein Size (# AA) 368 amino acids
Molecular Weight 43kDa
Subunit 1
NCBI Gene Id 6617
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Small nuclear RNA activating complex, polypeptide 1, 43kDa
Description
Alias Symbols SNAP43, PTFgamma
Peptide Sequence Synthetic peptide located within the following region: KMSLRNKGNVQNIHKEDKPLSLSMPVITEEEENESLSGTEFTASKKRRKH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gu,L., (2005) J. Biol. Chem. 280 (30), 27697-27704
Description of Target SNAPC1 is a part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. It binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes and recruits TBP and BRF2 to the U6 snRNA TATA box.
Protein Interactions UBC; TBP; SNAPC2; RHOXF2; TRIM29; NR2E3; HOXA10; SNAPC4; SNAPC3; RB1; SNAPC5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SNAPC1 (P100885_T100) antibody
Blocking Peptide For anti-SNAPC1 (P100885_T100) antibody is Catalog # AAP31223 (Previous Catalog # AAPP01968)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SNAPC1
Uniprot ID Q16533
Protein Name snRNA-activating protein complex subunit 1
Protein Accession # NP_003073
Purification Protein A purified
Nucleotide Accession # NM_003082
Tested Species Reactivity Human
Gene Symbol SNAPC1
Predicted Species Reactivity Human
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human 293T
WB Suggested Anti-SNAPC1 Antibody Titration: 2.5ug/ml
Positive Control: Transfected 293T
Image 2
Human pancreas
Human Pancrease
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com