Product Number |
P100884_T100 |
Product Page |
www.avivasysbio.com/lhx2-antibody-middle-region-p100884-t100.html |
Name |
LHX2 Antibody - middle region (P100884_T100) |
Protein Size (# AA) |
406 amino acids |
Molecular Weight |
44kDa |
NCBI Gene Id |
9355 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
LIM homeobox 2 |
Description |
|
Alias Symbols |
LH2, hLhx2 |
Peptide Sequence |
Synthetic peptide located within the following region: AEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Glenn,D.J., et al., (1999) J. Biol. Chem. 274 (51), 36159-36167 |
Description of Target |
LHX2 is a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator. The protein can recapitulate or rescue phenotypes in Drosophila caused by a related protein, suggesting conservation of function during evolution. |
Protein Interactions |
LDB1; CITED2; RLIM; MSX1; PAX6; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LHX2 (P100884_T100) antibody |
Blocking Peptide |
For anti-LHX2 (P100884_T100) antibody is Catalog # AAP31207 (Previous Catalog # AAPP01951) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LHX2 |
Uniprot ID |
P50458 |
Protein Name |
LIM/homeobox protein Lhx2 |
Protein Accession # |
NP_004780 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_004789 |
Tested Species Reactivity |
Human |
Gene Symbol |
LHX2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-LHX2 Antibody Titration: 2.5ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate |
|
|