EGR2 Antibody - C-terminal region (P100880_P050)

Data Sheet
 
Product Number P100880_P050
Product Page www.avivasysbio.com/egr2-antibody-c-terminal-region-p100880-p050.html
Name EGR2 Antibody - C-terminal region (P100880_P050)
Protein Size (# AA) 476 amino acids
Molecular Weight 50kDa
NCBI Gene Id 1959
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Early growth response 2
Description
Alias Symbols CHN1, AT591, CMT1D, CMT4E, KROX20
Peptide Sequence Synthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Yoo,Y.G., et al., (2004) J. Biol. Chem. 279 (35), 36242-36249
Description of Target The early growth response protein 2 (EGR2) is a transcription factor with three tandem C2H2-type zinc fingers. Mutations in this gene are associated with the autosomal dominant Charcot-Marie-Tooth disease, type 1.The early growth response protein 2 is a transcription factor with three tandem C2H2-type zinc fingers. Mutations in this gene are associated with the autosomal dominant Charcot-Marie-Tooth disease, type 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions RPL7L1; HN1L; RIMKLB; RBM15B; NDUFS2; BPGM; SRA1; DTX1; WWP2; UBC; UBE2I; NAB2; SOX8; MED31; SOX10; HCFC1; ACP5; NFATC1; FASLG;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-EGR2 (P100880_P050) antibody
Blocking Peptide For anti-EGR2 (P100880_P050) antibody is Catalog # AAP31178 (Previous Catalog # AAPP01921)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human EGR2
Uniprot ID P11161
Protein Name E3 SUMO-protein ligase EGR2
Publications

Damm, F. et al. Acquired initiating mutations in early hematopoietic cells of CLL patients. Cancer Discov. 4, 1088-101 (2014). 24920063

Lagrange, B. et al. A role for miR-142-3p in colony-stimulating factor 1-induced monocyte differentiation into macrophages. Biochim. Biophys. Acta 1833, 1936-46 (2013). 23602969

Latasa, M.-J., Ituero, M., Moran-Gonzalez, A., Aranda, A. & Cosgaya, J. M. Retinoic acid regulates myelin formation in the peripheral nervous system. Glia 58, 1451-64 (2010). 20648638

Protein Accession # NP_000390
Purification Affinity Purified
Nucleotide Accession # NM_000399
Tested Species Reactivity Human, Mouse, Rat
Gene Symbol EGR2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application IHC-P, IHC-F, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 92%; Horse: 85%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 92%; Rat: 92%
Image 1
Human Lung
Rabbit Anti-EGR2 Antibody
Catalog Number: P100880
Paraffin Embedded Tissue: Human bronchiole epithelium
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human Lung
WB Suggested Anti-EGR2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung
Image 3
Human Intestine
Human Intestine
Image 4
Human Jurkat Whole Cell
Host: Rabbit
Target Name: EGR2
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 1ug/ml
Image 5
Rat Skeletal Muscle
Host: Rat
Target Name: EGR2
Sample Tissue: Rat Skeletal Muscle
Antibody Dilution: 1ug/ml
Image 6
Human HepG2 Whole Cell
Host: Rabbit
Target Name: EGR2
Sample Tissue: Human HepG2 Whole Cell
Antibody Dilution: 1ug/ml
Image 7
Mouse Small Intestine
Host: Mouse
Target Name: EGR2
Sample Tissue: Mouse Small Intestine
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com