Product Number |
P100880_P050 |
Product Page |
www.avivasysbio.com/egr2-antibody-c-terminal-region-p100880-p050.html |
Name |
EGR2 Antibody - C-terminal region (P100880_P050) |
Protein Size (# AA) |
476 amino acids |
Molecular Weight |
50kDa |
NCBI Gene Id |
1959 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Early growth response 2 |
Description |
|
Alias Symbols |
CHN1, AT591, CMT1D, CMT4E, KROX20 |
Peptide Sequence |
Synthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Yoo,Y.G., et al., (2004) J. Biol. Chem. 279 (35), 36242-36249 |
Description of Target |
The early growth response protein 2 (EGR2) is a transcription factor with three tandem C2H2-type zinc fingers. Mutations in this gene are associated with the autosomal dominant Charcot-Marie-Tooth disease, type 1.The early growth response protein 2 is a transcription factor with three tandem C2H2-type zinc fingers. Mutations in this gene are associated with the autosomal dominant Charcot-Marie-Tooth disease, type 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
RPL7L1; HN1L; RIMKLB; RBM15B; NDUFS2; BPGM; SRA1; DTX1; WWP2; UBC; UBE2I; NAB2; SOX8; MED31; SOX10; HCFC1; ACP5; NFATC1; FASLG; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-EGR2 (P100880_P050) antibody |
Blocking Peptide |
For anti-EGR2 (P100880_P050) antibody is Catalog # AAP31178 (Previous Catalog # AAPP01921) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human EGR2 |
Uniprot ID |
P11161 |
Protein Name |
E3 SUMO-protein ligase EGR2 |
Publications |
Damm, F. et al. Acquired initiating mutations in early hematopoietic cells of CLL patients. Cancer Discov. 4, 1088-101 (2014). 24920063
Lagrange, B. et al. A role for miR-142-3p in colony-stimulating factor 1-induced monocyte differentiation into macrophages. Biochim. Biophys. Acta 1833, 1936-46 (2013). 23602969
Latasa, M.-J., Ituero, M., Moran-Gonzalez, A., Aranda, A. & Cosgaya, J. M. Retinoic acid regulates myelin formation in the peripheral nervous system. Glia 58, 1451-64 (2010). 20648638 |
Protein Accession # |
NP_000390 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000399 |
Tested Species Reactivity |
Human, Mouse, Rat |
Gene Symbol |
EGR2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
IHC-P, IHC-F, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 92%; Horse: 85%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 92%; Rat: 92% |
Image 1 | Human Lung
| Rabbit Anti-EGR2 Antibody Catalog Number: P100880 Paraffin Embedded Tissue: Human bronchiole epithelium Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
Image 2 | Human Lung
| WB Suggested Anti-EGR2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Lung |
|
Image 3 | Human Intestine
| Human Intestine |
|
Image 4 | Human Jurkat Whole Cell
| Host: Rabbit Target Name: EGR2 Sample Tissue: Human Jurkat Whole Cell Antibody Dilution: 1ug/ml |
|
Image 5 | Rat Skeletal Muscle
| Host: Rat Target Name: EGR2 Sample Tissue: Rat Skeletal Muscle Antibody Dilution: 1ug/ml |
|
Image 6 | Human HepG2 Whole Cell
| Host: Rabbit Target Name: EGR2 Sample Tissue: Human HepG2 Whole Cell Antibody Dilution: 1ug/ml |
|
Image 7 | Mouse Small Intestine
| Host: Mouse Target Name: EGR2 Sample Tissue: Mouse Small Intestine Antibody Dilution: 1ug/ml |
|