| Product Number |
P100865_T100 |
| Product Page |
www.avivasysbio.com/znf187-antibody-c-terminal-region-p100865-t100.html |
| Name |
ZNF187 Antibody - C-terminal region (P100865_T100) |
| Protein Size (# AA) |
325 amino acids |
| Molecular Weight |
36kDa |
| NCBI Gene Id |
7741 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 187 |
| Description |
|
| Alias Symbols |
SREZBP, ZNF187, SRE-ZBP |
| Peptide Sequence |
Synthetic peptide located within the following region: KAFRLNSHLAQHVRIHNEEKPYQCSECGEAFRQRSGLFQHQRYHHKDKLA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Attar,R.M. (1992) Mol. Cell. Biol. 12 (5), 2432-2443 |
| Description of Target |
ZNF187 may be involved in transcriptional regulation. |
| Protein Interactions |
KRTAP10-3; KRTAP10-5; KRTAP10-1; KRTAP10-9; KRTAP10-7; KRTAP10-4; FSD2; TRIM41; KRTAP4-12; CCDC136; CCNDBP1; MTUS2; PDE4DIP; LSM7; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZSCAN26 (P100865_T100) antibody |
| Blocking Peptide |
For anti-ZSCAN26 (P100865_T100) antibody is Catalog # AAP31231 (Previous Catalog # AAPP01976) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF187 |
| Uniprot ID |
Q16670-2 |
| Protein Name |
Zinc finger protein 187 |
| Sample Type Confirmation |
ZSCAN26 is supported by BioGPS gene expression data to be expressed in HEK293T |
| Protein Accession # |
NP_009082 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_007151 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZSCAN26 |
| Predicted Species Reactivity |
Human, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 92%; Human: 100%; Pig: 92% |
| Image 1 | Human 293T
 | WB Suggested Anti-ZNF187 Antibody Titration: 2.5ug/ml
Positive Control: Transfected 293TZSCAN26 is supported by BioGPS gene expression data to be expressed in HEK293T |
|
|
