| Product Number |
P100859_T100 |
| Product Page |
www.avivasysbio.com/pax2-antibody-middle-region-p100859-t100.html |
| Name |
PAX2 Antibody - middle region (P100859_T100) |
| Protein Size (# AA) |
417 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
5076 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Paired box 2 |
| Alias Symbols |
FSGS7, PAPRS |
| Peptide Sequence |
Synthetic peptide located within the following region: VSSASNDPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Muratovska, A., et al., (2003) Oncogene 22 (39), 7989-7997. |
| Description of Target |
PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. |
| Protein Interactions |
BBS7; BBS4; BBS2; BBS1; RB1; BRCA1; SFRP2; PAXIP1; WT1; MAPK8IP1; MAPK8; ID2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PAX2 (P100859_T100) antibody |
| Blocking Peptide |
For anti-PAX2 (P100859_T100) antibody is Catalog # AAP31220 (Previous Catalog # AAPP01965) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PAX2 |
| Uniprot ID |
Q02962 |
| Protein Name |
Paired box protein Pax-2 |
| Protein Accession # |
NP_003979 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_003988 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PAX2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%; Sheep: 100%; Zebrafish: 100% |
| Image 1 | Human MCF7
 | WB Suggested Anti-PAX2 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate |
|
| Image 2 | Human Fetal Kidney
 | WB Suggested Anti-PAX2 Antibody Titration: 1.0ug/mlELISA Titer: 1:312500Positive Control: Fetal Kidney |
|
| Image 3 | Human Kidney
 | Rabbit Anti-PAX2 Antibody
Catalog Number: p100859
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 4 | Human Ovary Tumor
 | Host: Rabbit
Target Name: PAX2
Sample Tissue: Human Ovary Tumor
Antibody Dilution: 1ug/ml |
|
