Product Number |
P100859_T100 |
Product Page |
www.avivasysbio.com/pax2-antibody-middle-region-p100859-t100.html |
Name |
PAX2 Antibody - middle region (P100859_T100) |
Protein Size (# AA) |
417 amino acids |
Molecular Weight |
45kDa |
NCBI Gene Id |
5076 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Paired box 2 |
Description |
|
Alias Symbols |
FSGS7, PAPRS |
Peptide Sequence |
Synthetic peptide located within the following region: VSSASNDPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Muratovska, A., et al., (2003) Oncogene 22 (39), 7989-7997. |
Description of Target |
PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. |
Protein Interactions |
BBS7; BBS4; BBS2; BBS1; RB1; BRCA1; SFRP2; PAXIP1; WT1; MAPK8IP1; MAPK8; ID2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PAX2 (P100859_T100) antibody |
Blocking Peptide |
For anti-PAX2 (P100859_T100) antibody is Catalog # AAP31220 (Previous Catalog # AAPP01965) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PAX2 |
Uniprot ID |
Q02962 |
Protein Name |
Paired box protein Pax-2 |
Protein Accession # |
NP_003979 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_003988 |
Tested Species Reactivity |
Human |
Gene Symbol |
PAX2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%; Sheep: 100%; Zebrafish: 100% |
Image 1 | Human MCF7
| WB Suggested Anti-PAX2 Antibody Titration: 1.0ug/ml ELISA Titer: 1:312500 Positive Control: MCF7 cell lysate |
|
Image 2 | Human Fetal Kidney
| WB Suggested Anti-PAX2 Antibody Titration: 1.0ug/mlELISA Titer: 1:312500Positive Control: Fetal Kidney |
|
Image 3 | Human Kidney
| Rabbit Anti-PAX2 Antibody Catalog Number: p100859 Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
Image 4 | Human Ovary Tumor
| Host: Rabbit Target Name: PAX2 Sample Tissue: Human Ovary Tumor Antibody Dilution: 1ug/ml |
|